PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 308aa    MW: 32787.4 Da    PI: 4.6137
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011020.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox611.8e-1985138356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k+++++++q+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Do011020.1  85 KKRRLSTDQVRALERSFETENKLEPERKARLAQDLGLQPRQVAVWFQNRRARWK 138
                 45689************************************************9 PP

2HD-ZIP_I/II133.86e-4384176193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrls++qv++LE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+ke
   Do011020.1  84 EKKRRLSTDQVRALERSFETENKLEPERKARLAQDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRADHDALRRDKDTLLAEIKE 176
                  69**************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-1975142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-2082144IPR009057Homeodomain-like
SMARTSM003891.3E-1883144IPR001356Homeobox domain
PROSITE profilePS5007117.18484140IPR001356Homeobox domain
CDDcd000861.35E-1885141No hitNo description
PfamPF000461.2E-1685138IPR001356Homeobox domain
PRINTSPR000311.0E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.0E-5120136IPR000047Helix-turn-helix motif
PfamPF021831.4E-17140181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MKRPSAAISG GGGSPGLLPM VHSGKVSADL FLRRCLVMSS VSASSDGLAY VGFVWKDDGF  60
GGVGVEEADE DMVLCSGGGC GGGEKKRRLS TDQVRALERS FETENKLEPE RKARLAQDLG  120
LQPRQVAVWF QNRRARWKTK QLERDYAALR HSYDALRADH DALRRDKDTL LAEIKELKAK  180
LGDEDAAASF SSVKEEPAAS DVEPPAAVAQ GSSDSDDSSG VVNDAEMAPE KAPPAAAAAG  240
TEAVVPGAAA SQAQALHHGE VFFHGHLLKV EDDEAAFLGD DDAACGGFFA DLQPPSLPWW  300
TEPTEPWA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109115ERKARLA
2132140RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011020.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated in leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0918721e-178FP091872.1 Phyllostachys edulis cDNA clone: bphylf046i13, full insert sequence.
GenBankFP0923981e-178FP092398.1 Phyllostachys edulis cDNA clone: bphylf024g13, full insert sequence.
GenBankFP0944211e-178FP094421.1 Phyllostachys edulis cDNA clone: bphylf034o12, full insert sequence.
GenBankFP0957961e-178FP095796.1 Phyllostachys edulis cDNA clone: bphylf053b02, full insert sequence.
GenBankFP0963141e-178FP096314.1 Phyllostachys edulis cDNA clone: bphylf059i02, full insert sequence.
GenBankFP0972081e-178FP097208.1 Phyllostachys edulis cDNA clone: bphylf060f04, full insert sequence.
GenBankFP0985541e-178FP098554.1 Phyllostachys edulis cDNA clone: bphyst007g13, full insert sequence.
GenBankFP0999551e-178FP099955.1 Phyllostachys edulis cDNA clone: bphyst012d13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822160.11e-131homeobox-leucine zipper protein HOX20-like
SwissprotA2YWC01e-119HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2481e-119HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLA0A1E5UJN70.0A0A1E5UJN7_9POAL; Homeobox-leucine zipper protein HOX20
STRINGSi014231m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-41homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]