PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family CPP
Protein Properties Length: 814aa    MW: 88173.7 Da    PI: 6.2643
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010746.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.94.7e-14460500240
         TCR   2 ekkgCnCkkskClkk..YCeCfaagkkCseeCkCedCkNke 40 
                  +k+C+CkkskClk+  YCeCfaag++Cse C+C++C+Nk 
  Do010746.1 460 ACKRCSCKKSKCLKLyvYCECFAAGVYCSEPCSCQGCMNKP 500
                 589***********8446*********************96 PP

2TCR50.15.3e-16547586140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Do010746.1 547 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 586
                 589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.3E-14459502IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.582460587IPR005172CRC domain
PfamPF036388.7E-10462499IPR005172CRC domain
SMARTSM011143.5E-16547588IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11549585IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MDTPDRAAAQ PAASRAEDSP VFSFINNLSP IEPLKSVYNT NSLQGYQSIN ITSISSIFTS  60
PHDNVHKEPR LPKSSLGEIS ESEVCADGSN TNKPTKSSNA VRLFACTSTV TQETHTVTCS  120
DVVDPATGSC DLAQPAQFDN GSPDHNTTPC HGVRSDLKQD KCRKLDVVQT VKNTVEKRKC  180
LFSTEIQLMD GGLSVNDNDE VLGCEWADLI STTSGELLAF DSTMDEHHRG VHLAAKNAES  240
CGYLLSKLTG DGEISDRAPP SASGQVYYQE LMMGEDQTEN AEMFQDGQQT ISTEEIQDNI  300
YEANGCIPLD YKVESQQRGI RRRCLVFEAA GFSNSVVQKE TVENLSVSKS KGKSHVQTQP  360
RGLRGIGLHL NALALTPKGK MACLDTMASA LLPSSASEKD AHVKLLSAGE SFPHSGGELL  420
EFPMDDCSAG DFPVNDHVSS QSVSPQKKRR KTDNGDDGEA CKRCSCKKSK CLKLYVYCEC  480
FAAGVYCSEP CSCQGCMNKP IHEETVLSTR KQIEFRNPLA FAPKVIRMSD AGPETGEDPN  540
STPASARHKR GCNCKKSSCL KKYCECYQGG VGCSSNCRCE SCKNTFGRRD GEHLTFVVSD  600
TELTEEMKQE GEQTENCGKE KENDQQKANV QNEDHPLLEL VPITPPFDLS SSLLKLPNFS  660
SAKPPRPSKA RSGNSRLSAS KAATTLQSCK SSKVAGSDID EEMPDILKEA NSPNSCVKTT  720
SPNGKRVSPP HNALSISPNR KGGRKLILKS IPSFPSLMGD SNSGSKMSNT DNTFSASPLA  780
LGKHCFCTCR QHMCYLEIDG SISFILLSTE PGPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1446450KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0620031e-148AK062003.1 Oryza sativa Japonica Group cDNA clone:001-043-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955606.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLK3ZQR90.0K3ZQR9_SETIT; Uncharacterized protein
STRINGSi028949m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-86TESMIN/TSO1-like CXC 2