PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 307aa    MW: 33668 Da    PI: 7.1246
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010623.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.24e-50111391129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deelv++yL++kv++++l    ++ evd++  ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ v++  +++
  Do010623.1  11 LPPGFRFYPSDEELVCFYLRNKVANQRLAS-GTLVEVDLHAREPWELPDVAKLTADEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDRVVHELgTRA 108
                 79*************************998.88***************77777889************************************9986677 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg++ktLvfy grap+g+kt Wvmhe+rle
  Do010623.1 109 LVGMRKTLVFYLGRAPNGQKTGWVMHEFRLE 139
                 8***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-607157IPR003441NAC domain
PROSITE profilePS5100558.19811157IPR003441NAC domain
PfamPF023652.9E-2812138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MMGLREMDSA LPPGFRFYPS DEELVCFYLR NKVANQRLAS GTLVEVDLHA REPWELPDVA  60
KLTADEWYFF SFRDRKYATG SRTNRATKTG YWKATGKDRV VHELGTRALV GMRKTLVFYL  120
GRAPNGQKTG WVMHEFRLET PNSTPKEDWV LCRVFNKMKP SSEGEEGSTM IHHGHAATAA  180
GGAGPSSPPA FLGSLIPEPT ATTPADKFYQ QRQATTTGSH CGRGSSSGAL LMNNLATLQQ  240
GGSFLDYCSP VVHHGVAFGP RNSGCGDDAA MAMALGHVGF EEHVMGEIEM EHSQTLGGCC  300
YKDGLYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5321574165NO APICAL MERISTEM PROTEIN
1ut4_B2e-5321574165NO APICAL MERISTEM PROTEIN
1ut7_A2e-5321574165NO APICAL MERISTEM PROTEIN
1ut7_B2e-5321574165NO APICAL MERISTEM PROTEIN
3swm_A2e-5321577168NAC domain-containing protein 19
3swm_B2e-5321577168NAC domain-containing protein 19
3swm_C2e-5321577168NAC domain-containing protein 19
3swm_D2e-5321577168NAC domain-containing protein 19
3swp_A2e-5321577168NAC domain-containing protein 19
3swp_B2e-5321577168NAC domain-containing protein 19
3swp_C2e-5321577168NAC domain-containing protein 19
3swp_D2e-5321577168NAC domain-containing protein 19
4dul_A2e-5321574165NAC domain-containing protein 19
4dul_B2e-5321574165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1814922e-87KC181492.1 Urochloa ruziziensis clone 214913 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982866.11e-177PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLK4AD781e-177K4AD78_SETIT; Uncharacterized protein
STRINGSi036835m1e-176(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-79NAC domain containing protein 74