PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 356aa    MW: 37404.7 Da    PI: 6.5176
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010618.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.7e-17171225256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Do010618.1 171 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLLPRQVEVWFQNRRARTK 225
                 788899***********************************************98 PP

2HD-ZIP_I/II124.64.6e-40171261192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rlskeq+++LEesF+e+ +L+p++K +la++L+l prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
   Do010618.1 171 RKKLRLSKEQSAFLEESFKEHATLNPKQKLALAKQLNLLPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELAELR-ALK 261
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-17156221IPR009057Homeodomain-like
SuperFamilySSF466891.33E-17159228IPR009057Homeodomain-like
PROSITE profilePS5007116.73167227IPR001356Homeobox domain
SMARTSM003899.9E-16169231IPR001356Homeobox domain
CDDcd000865.05E-17171228No hitNo description
PfamPF000469.4E-15171225IPR001356Homeobox domain
PROSITE patternPS000270202225IPR017970Homeobox, conserved site
CDDcd146860.00765220259No hitNo description
SMARTSM003401.4E-24227270IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-10227261IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELGLSLGET MADAGRDLVL GLGMGIGVGA SKDEEAGTVR EARRELEFGA GRRCGRPSPE  60
PAVRLTLVPS LGGLPWPPSS SEATRHLEAS TRGFDVNRAP SLSVAGAAAE DDEEQDDAGA  120
GAAAAAASSS PNDSAGSFPT DFCPQGQAST GGGGDRAGSR ASDDDDGGSA RKKLRLSKEQ  180
SAFLEESFKE HATLNPKQKL ALAKQLNLLP RQVEVWFQNR RARTKLKQTE VDCEYLKRCC  240
ETLTEENRRL QKELAELRAL KTVHPFYMHL PATTLSMCPS CERVASNPTS ASASAPASST  300
PPPATPAIAT TNHTAAVAAP ARAEHRPTSF AALFSSPLNR PPVAQPQPQA QAPASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1219227RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo010618.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802237.11e-148homeobox-leucine zipper protein HOX11-like
SwissprotQ67UE21e-135HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLA0A1E5V7400.0A0A1E5V740_9POAL; Homeobox-leucine zipper protein HOX11
STRINGPavir.J20342.1.p1e-149(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-53homeobox from Arabidopsis thaliana