PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 1778aa    MW: 201533 Da    PI: 7.3703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010510.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS140.51.7e-432384071172
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA av+++d  l+++l++++++++s dgd +qRla+y++ +L+arla+ +s++y+ l +++ s   +++++++++l   ++P+++ s+  aN
  Do010510.1 238 LRTLLIHCAPAVAADDRLLVTELIKKIRQHSSVDGDCTQRLAFYLADGLEARLAGIGSQVYHRLMAKRVS---VEDVFKIYNLCLAAFPLHRASYTFAN 333
                 6789************************************************************999998...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeel 172
                 ++I ea +g+++vHiiDf+i  G+QWp+L+q++a++ + pp+lRiTg++ p++g    e  e+ g+rLa++A+ +
  Do010510.1 334 RTIIEASKGQSKVHIIDFGICSGFQWPSLIQKFAEQ-GVPPNLRITGIDVPQPGfgPLEINEQAGKRLADYANMF 407
                 ***********************************6.889*************9988899999*********875 PP

2GRAS152.15e-47408584198374
        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 ++E+l+Vn+++++ rl de+v+++s+rd+vLk++++++ kv+++   + +++s+ F +rf e l +ys+lfd++++++pr++e+r+ +E +llgre+ n
  Do010510.1 408 KNEVLIVNCMYRMRRLGDETVDMNSARDRVLKIIRRMNTKVFILGIVNGSYSSPFFITRFKELLFHYSSLFDMFDVNVPRDNEARKLLEGRLLGREALN 506
                 78************************************************************************************************* PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 v+acegaer+ r et+++W+ r  +aGF+++p++ ++ +++  + + ++ + +  +e+ g+l++gWk+r + ++S W+
  Do010510.1 507 VIACEGAERTDRPETYKQWQVRCLKAGFEQLPVDPDVLNSILEMKKGIYHEDFVADEDTGWLLQGWKGRVMHAISKWK 584
                 *************************************************999*************************8 PP

3GRAS319.19.5e-9884211562316
        GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98  
                  + lL++cAea++s+++   ++lL+r ++++sp+gd  qRla yf  AL+arla+++s++y++l +++ts   +++ l+a++lf  ++P+ k+++   
  Do010510.1  842 RALLIQCAEAIASNNQPFDRELLTRTRNRSSPYGDGSQRLAIYFIDALEARLAGTGSQMYQKLIAKRTS---TTDMLKAYRLFTAACPFTKVAYYYS 935 
                  679************************************************************999998...89*********************** PP

        GRAS   99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193 
                  Nq+I++ +eg  rvHiiDf+i+ G+QWp+L+q +a+R++gpp+lRiTg++ +e+g    +++eetg+rLa++Ae ++vpf+++  +a+r+e++ +e+
  Do010510.1  936 NQTIVDVLEGRPRVHIIDFGITFGFQWPSLIQRFANREGGPPNLRITGIDVAETGfrPCKRIEETGKRLAEYAEMFNVPFQYQG-LASRWENICIED 1031
                  ***************************************************99999999*************************.6*********** PP

        GRAS  194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres..eerikvEre 288 
                  L+++++E+l++n+ +q+++l d + +++s+rd+vL+l+k+++P v+++  ++ + +s+ Fl rf eal yys+lfd+l+++++r +  e+ri +Er 
  Do010510.1 1032 LNIDKDEVLIINCLYQMKNLGDATEDIDSARDRVLRLMKRINPGVLIIGVENGSNSSPFFLPRFREALFYYSSLFDMLNSTVARSHghEARILIERD 1128
                  ******************************************************9***************************9999989******** PP

        GRAS  289 llgreivnvvacegaerrerhetlekWr 316 
                  llg ++vnvvacegaer+er  ++++W+
  Do010510.1 1129 LLGADVVNVVACEGAERIERPANYKQWQ 1156
                  ***************************8 PP

4GRAS366.24.6e-112140017702374
        GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98  
                  + +L++cA+a+++++l  a++lL++++++asp+gd  qRla yf+++L+arla+++s++y++l  ++t+    ++ l+a++lf  ++P+ ++++   
  Do010510.1 1400 RAVLIQCARAIAENNLPFASELLKKIRHHASPYGDGSQRLALYFANGLEARLAGTGSQIYQKLMEKRTR---ATDMLKAYRLFIAACPFARVAYYFS 1493
                  789************************************************************999998...99*********************** PP

        GRAS   99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193 
                  Nq+I + +eg  +vHiiDf+i+ G+QWp+L+q +a R++gpp+lRiTg++ p+sg      +e+tg+rLa++Ae ++vpf+++  +a+r+e++ +++
  Do010510.1 1494 NQTIADVLEGRPKVHIIDFGITLGFQWPSLIQRFAMREGGPPKLRITGIDVPQSGfhPCALIESTGKRLAEYAEMFNVPFQYQG-IASRWENICINN 1589
                  ******************************************************99888999**********************.7*********** PP

        GRAS  194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290 
                  L+++++E+l++n+++++++l de+ +++ +rd+vL+++k+++P+v+++   +  ++s+ Fl rf e l +ys+lfd+l++++ +++eeri +Er ll
  Do010510.1 1590 LNIDNDEVLIINCMYRMKYLGDETEDIDCPRDRVLRIMKRINPEVLILGIVNGLYSSPFFLPRFREVLFHYSSLFDMLNTTVLQNHEERIQIERDLL 1686
                  ************************************************************************************************* PP

        GRAS  291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 
                  g  + nvvacegaer+er et+++W+ r  +aGFk++p+++++ k      +k++ d++ ++e+sg+l++gWk+r + +vS+W+
  Do010510.1 1687 GAGALNVVACEGAERVERPETYKQWQVRSLKAGFKQLPVNQTILKRSIDEKNKHYHDEFVINEDSGWLLQGWKGRIMHAVSSWK 1770
                  *********************************************9999999999999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.377212564IPR005202Transcription factor GRAS
PfamPF035146.0E-41238407IPR005202Transcription factor GRAS
PfamPF035141.7E-44408584IPR005202Transcription factor GRAS
PROSITE profilePS500848.576727788IPR004088K Homology domain, type 1
PROSITE profilePS5098558.2728151194IPR005202Transcription factor GRAS
PfamPF035143.3E-958421156IPR005202Transcription factor GRAS
PROSITE profilePS5098564.78913731750IPR005202Transcription factor GRAS
PfamPF035141.6E-10914001770IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1778 aa     Download sequence    Send to blast
MKGALQAAEK GFYEILGQVY PASWTPLCSS NEAYGPDESR NNCQKRPRRT SFTSDISSHS  60
MLHPLPAPSS PYNYGRSLFL PYQPLTSIGR AARFGFPALQ IIRGAEDAKG YDKLVIYLDS  120
GKLSICRLTT KAKVVKESKY RVFEITDHRN NPYIQDLDTR EGRSSKQHTN TITCEIRQNR  180
KFDRILLCYR LDCFDETRSL QELMAKQASM TSPKGQSKGP AQQKLRGKRQ INKEVVDLRT  240
LLIHCAPAVA ADDRLLVTEL IKKIRQHSSV DGDCTQRLAF YLADGLEARL AGIGSQVYHR  300
LMAKRVSVED VFKIYNLCLA AFPLHRASYT FANRTIIEAS KGQSKVHIID FGICSGFQWP  360
SLIQKFAEQG VPPNLRITGI DVPQPGFGPL EINEQAGKRL ADYANMFKNE VLIVNCMYRM  420
RRLGDETVDM NSARDRVLKI IRRMNTKVFI LGIVNGSYSS PFFITRFKEL LFHYSSLFDM  480
FDVNVPRDNE ARKLLEGRLL GREALNVIAC EGAERTDRPE TYKQWQVRCL KAGFEQLPVD  540
PDVLNSILEM KKGIYHEDFV ADEDTGWLLQ GWKGRVMHAI SKWKPKESCA DHPEYCEINS  600
NTTLEYINRI LMEEDVDENA SIYQERDALQ ATEKPFYDIL EQAYPSSAKE TVMNSDSQVD  660
YPDDSINNYH EGACSGSLVN DFLGPQGMHL TANGCASQND HLSLQFTKGA EEANKFVPII  720
EKLAVDLDSS ELAVSKQMTE AIVGQKGKHV NKIRSHPHVN LELLDARNSK HLAISGSETI  780
RDETFDSVLL CTGQLYRDAA HLRGMKEKEV RDSSQNAQNK GYGQGQVKSR AKKQQEEVTD  840
FRALLIQCAE AIASNNQPFD RELLTRTRNR SSPYGDGSQR LAIYFIDALE ARLAGTGSQM  900
YQKLIAKRTS TTDMLKAYRL FTAACPFTKV AYYYSNQTIV DVLEGRPRVH IIDFGITFGF  960
QWPSLIQRFA NREGGPPNLR ITGIDVAETG FRPCKRIEET GKRLAEYAEM FNVPFQYQGL  1020
ASRWENICIE DLNIDKDEVL IINCLYQMKN LGDATEDIDS ARDRVLRLMK RINPGVLIIG  1080
VENGSNSSPF FLPRFREALF YYSSLFDMLN STVARSHGHE ARILIERDLL GADVVNVVAC  1140
EGAERIERPA NYKQWQINSN MTLNYINRLL MEEDSDEKDS IYQRHDALQA TEKPFYDILG  1200
QAYPSSPKET MINIDNQVDC PQDSCNNYTE RACSGSFVSA ILGPQVMHLV ANDWASECDH  1260
LSSQFERGAE EANKLVPSIE KLVVDLDSNG LSDSNQMIGA AIGQKSKHVS KIRSHPHVDL  1320
ELLQARNSKH LAILASETIR DEMFDSVLLC DWQLQCDAAQ LREMKAKEAS NCSQNVQSKG  1380
NGQGQVRSRC KKKEEGIDLR AVLIQCARAI AENNLPFASE LLKKIRHHAS PYGDGSQRLA  1440
LYFANGLEAR LAGTGSQIYQ KLMEKRTRAT DMLKAYRLFI AACPFARVAY YFSNQTIADV  1500
LEGRPKVHII DFGITLGFQW PSLIQRFAMR EGGPPKLRIT GIDVPQSGFH PCALIESTGK  1560
RLAEYAEMFN VPFQYQGIAS RWENICINNL NIDNDEVLII NCMYRMKYLG DETEDIDCPR  1620
DRVLRIMKRI NPEVLILGIV NGLYSSPFFL PRFREVLFHY SSLFDMLNTT VLQNHEERIQ  1680
IERDLLGAGA LNVVACEGAE RVERPETYKQ WQVRSLKAGF KQLPVNQTIL KRSIDEKNKH  1740
YHDEFVINED SGWLLQGWKG RIMHAVSSWK PKESCSNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-5024217708375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963450.10.0PREDICTED: uncharacterized protein LOC101786830
TrEMBLA0A0D3G2F50.0A0A0D3G2F5_9ORYZ; Uncharacterized protein
STRINGORGLA05G0007900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-147GRAS family protein