PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do010311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family CPP
Protein Properties Length: 1070aa    MW: 116375 Da    PI: 7.1595
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do010311.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.66e-14764801340
         TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 +k+C+CkkskClk+YC Cfa+g++Cse+C Ce C Nk 
  Do010311.1 764 CKTCSCKKSKCLKLYCVCFASGSHCSESCGCEPCLNKP 801
                 89**********************************96 PP

2TCR45.61.4e-14840875439
         TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++C+Ckks ClkkYC+C++ g+ Cs +CkCedC+N 
  Do010311.1 840 RKCTCKKSGCLKKYCDCYQGGAGCSINCKCEDCRNP 875
                 79********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.0E-10762803IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.312763877IPR005172CRC domain
PfamPF036387.3E-10765800IPR005172CRC domain
SMARTSM011142.0E-15837878IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-10840874IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 1070 aa     Download sequence    Send to blast
MDTPDRPRAA AAGGFEDSPV FNFINNLSPI PPPKPSDTAH NLQLFKSSDL APVSSIFASP  60
HVNPAKESKI LIRDDSVQLP QDLHSPNCVR TRVGSTITFR MIRCSDIVSE NCNITCQLNE  120
ASIDSSDQTS NSKSQLPQST QNGVVSVESD KDQCADVKTD LTISQECTSL ESMNLDESGP  180
DKMDSSHSGV DVHGNQLSEQ NKDEPAAYNG DYMITNQPSS DTLTSGLPFG TETQSVNDTQ  240
KGENSYSCKS LLNEESSDYY IQNSAHEPHL YWTGAVEGAA VNYTPQVLPG ALQSQLMPCN  300
KLNEPRDYMP TEQNALSQNL RGMRRRSLFN EKAGASNKGV DKSSDRHSVN STPKCKTISG  360
DNSKPLRTPP CALPGIGLHL NTLAAIPKEK IVSQEIQSTI NESTNLPCPA GSSSLPSEQN  420
IIIDDFVQTT DVVSSEPSSQ GSPKKKRHKF GNGDGTSCKR CSCKKSKCLK LNHVLHFAIH  480
KKATIFLRAF FNLIQGIAAL EEPNQAPEGT NACVKEEKIE IDKQLVIYQA TDLAPAGNVL  540
TTPSMVECRF ECQLSYLQVF ASGRVDLHAS QHELPSMSKT ISSKGSKRKP NRIQGGNGRS  600
EPSSCHARIA KTPFHQRLAS CLPSPPAPPP RLSRSLRFVA TASPTPPQPP IGAPPPAPDP  660
MEVEEEPPKL PQPEPAGSEP DDARNTSPPP PPPPPPAPTP VPAPVPAPAA EAYAASPISA  720
AAAAVSPPPA EANGNSDRKK KSVRRLPFPF SAKFWRKADD GEGCKTCSCK KSKCLKLYCV  780
CFASGSHCSE SCGCEPCLNK PMQGAPRAAP VLPLKPVQTL ETGQDSMEQL IRSPMDLIRR  840
KCTCKKSGCL KKYCDCYQGG AGCSINCKCE DCRNPFGRKV GVILDGKNAL AAPVLNERNG  900
AEVDSSDDED DYYMNRQLSP IPPSPVSRES SFQQETLVGV EVQTMNGHLY PKPLTQVRPE  960
PPSWQLSRRP VEEARGEQWR FSRRPSEDGT CDAMEAHAMA QRDNKKPETH VDRYSIPRCI  1020
EVMSAMADLS PIEKSLAPDV FLDPSNREIF LSLSVDIRPI WLRRKMKSLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963116.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLK3Z3P10.0K3Z3P1_SETIT; Uncharacterized protein
STRINGSi021159m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.17e-18TESMIN/TSO1-like CXC 2