PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009658.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 707aa    MW: 78524.8 Da    PI: 5.0778
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009658.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS326.74.6e-1003287001373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA+a+++gd   a++lL +++ ++sp+gd++qRla++f ++L+arla+++s++yk+l +++ s    +e  +a++l+  v+ +  +++   N
  Do009658.1 328 LRTLLIHCAQAMATGDSLHATELLREIKRRSSPRGDATQRLAHCFGQGLEARLAGTGSQVYKSLMARRPS---AVEFHKAYRLYLTVCCFQMIAFKFSN 423
                 6789************************************************************999998...89999********************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                   I +a+ g ++vHi+D++  +G+QWp+Ll  + + ++gpp+++iT+++ p++g   + ++e+tg++L++fA+++gvpf+fn  ++ ++e++  ++L++
  Do009658.1 424 MIIWKAITGRKKVHIVDYGGHYGFQWPTLLGFFGTWKGGPPEVKITAIDLPQPGfrPAARVEQTGRQLSNFARQCGVPFKFNS-IVAKWETVYADDLSI 521
                 *****************************************************9*9***************************.6999*********** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                 +p+E+l+Vn  ++  +l+de ++++s  +rd vL+ +++++P+v++++ +++++n++ F++rf eal yysa+fd+++a++pr++ er+ vE+ ++gr 
  Do009658.1 522 EPDEVLIVNGLFHFGKLMDEGGDIDSpsPRDMVLRNIQKMRPDVFILCTENSSYNAPFFVTRFREALFYYSAMFDMMDATAPRDNAERVLVEQDIFGRC 620
                 *********************99998889********************************************************************** PP

        GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 + n++aceg +r+er e ++kW+ r ++aG++++pl+ +++k ++  ++  + + + ++ ++++l++gWk+r L+++S W
  Do009658.1 621 ALNAIACEGLDRVERPEVYKKWQVRNDRAGLRELPLNLDIVKAVSKKVKDGYHKDFVIDVDQQWLLQGWKGRILYAMSTW 700
                 *************************************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.737302681IPR005202Transcription factor GRAS
PfamPF035141.6E-97328700IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MAAGPEDVAD DPEPFSPSDF LDLPPTPRPD GDGGPVPRDD DDLVLPFITR VLMEEEDIDD  60
NDPDYPALLE AQQPFADILS DAAASSATKH SGFDSAAANT DGSVPVPLFP DAPAFANATW  120
PHDPVELSQM LLLSRTTHPD IGAISKQHGS SEFMPAGGGE DDDSLASTLF GGRNRVTMDM  180
LNQAFLKGME EANKFLPTTN SSLLMATSGE YLLPRDSKQP HVFFAGRQAK TTGMVDGVSI  240
FQEIAANGRG RKNRHTNWDN LEAETGRSCK LMAPETEEAS EVVDEFILNG YQSLVQSMRD  300
MSISTDREAK KNTRKGRGST NTDEAVDLRT LLIHCAQAMA TGDSLHATEL LREIKRRSSP  360
RGDATQRLAH CFGQGLEARL AGTGSQVYKS LMARRPSAVE FHKAYRLYLT VCCFQMIAFK  420
FSNMIIWKAI TGRKKVHIVD YGGHYGFQWP TLLGFFGTWK GGPPEVKITA IDLPQPGFRP  480
AARVEQTGRQ LSNFARQCGV PFKFNSIVAK WETVYADDLS IEPDEVLIVN GLFHFGKLMD  540
EGGDIDSPSP RDMVLRNIQK MRPDVFILCT ENSSYNAPFF VTRFREALFY YSAMFDMMDA  600
TAPRDNAERV LVEQDIFGRC ALNAIACEGL DRVERPEVYK KWQVRNDRAG LRELPLNLDI  660
VKAVSKKVKD GYHKDFVIDV DQQWLLQGWK GRILYAMSTW VAKDATS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-423327008374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450068.10.0hypothetical protein SORBIDRAFT_05g027783, partial
TrEMBLC5Y8M00.0C5Y8M0_SORBI; Putative uncharacterized protein Sb05g027783 (Fragment)
STRINGSb05g027783.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-137GRAS family protein