PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009503.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 473aa    MW: 52187.2 Da    PI: 7.6133
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009503.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32240294155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rWt++LHerFv++v+qLGG++kAtPk il+lm+ +gLt++h+kSHLQkYR+
  Do009503.1 240 KTRIRWTQDLHERFVDCVNQLGGADKATPKGILKLMNSDGLTIYHIKSHLQKYRI 294
                 68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.662237297IPR017930Myb domain
SuperFamilySSF466891.02E-17238294IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-30239295IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-24240295IPR006447Myb domain, plants
PfamPF002499.0E-9244293IPR001005SANT/Myb domain
PfamPF143792.5E-9326348IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143796.6E-8397422IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MMNTKKIKLH DHHYGSPLCD PQMFQATAAA GLSFHPGLVS SLPQQHGGAG GWLHEEYSPT  60
PRTVLATQGS CVGSDTAAFF AAEHLLGMSQ FDFPLGTTTL PATMTAAKTT PFVRSPQAEQ  120
LYRQVDPLLR DNSVRTYYVR PQQRDATEAP PALKLPLQQQ HQEQVHGLYG NGSNGRLLGG  180
EPKAHSFSAH VTANTLLPAM EAPGTQSPIE SSLSRNCSIG APASHTGNVV AAPGHGAPSK  240
TRIRWTQDLH ERFVDCVNQL GGADKATPKG ILKLMNSDGL TIYHIKSHLQ KYRIAKYMPA  300
STSEGKQQEK RAAGKDAQNP DPSTGMQITE ALRVQLDVQR RLHEQLEVLC LRVKHYYREK  360
ETLNPTWILS RYISVCLCVC VCVDDIKLFA DILFCVQIQR NLQLRIEAQG KRLQKMFEEQ  420
LKASRTVMEP REEAQGEFAG VSEQDEEETF EDVQLLSVAS SVYNGAGFQS KIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-22240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-22240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-22240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-22240297158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-22240297259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo009503.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025822779.10.0probable transcription factor KAN2
RefseqXP_025822780.10.0probable transcription factor KAN2
TrEMBLA0A1E5VY920.0A0A1E5VY92_9POAL; Myb family transcription factor PHL5
STRINGSi022099m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.19e-53G2-like family protein