PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 329aa    MW: 35711.2 Da    PI: 4.5103
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009454.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.4e-2074127356
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFqNrRa++k
  Do009454.1  74 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWK 127
                 5678*************************************************9 PP

2HD-ZIP_I/II131.92.3e-4273165193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFqnrRAR+ktkqlE+d+++Lk+++dal+++++ L +++++Lr+++++
   Do009454.1  73 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDVLLQDNHRLRSQVAS 165
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.04E-2067131IPR009057Homeodomain-like
PROSITE profilePS5007118.2269129IPR001356Homeobox domain
SMARTSM003892.0E-2072133IPR001356Homeobox domain
PfamPF000467.5E-1874127IPR001356Homeobox domain
CDDcd000865.38E-2074130No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2275136IPR009057Homeodomain-like
PRINTSPR000312.1E-6100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000312.1E-6109125IPR000047Helix-turn-helix motif
PfamPF021836.0E-17129170IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MESGRLIFNA TGSGAGQMLF LDCGAGGGPG GGLFHRGGRP MLGLEEGRGV KRPFFTSPDE  60
LLEEEYYDEQ LPEKKRRLTP EQVHLLERSF EEENKLEPER KTELARKLGL QPRQVAVWFQ  120
NRRARWKTKQ LERDFDRLKA SFDALRADHD VLLQDNHRLR SQVASLTEKL KEKEVTEGGA  180
SAAADAAELP VDAVKASLAD GIEEPAAEAA FEAHQVKSED RLSTGSGGSA VVDTDALLCG  240
RFGAAVDSSV ESYFPGGEDH YHDCGMGAVN HGAGGIQSDD DGAGSDEGCS YYAEEEAAAA  300
AAFFAGHAAH HQADDEEDAG QISWSWMWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1121129RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo009454.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0652670.0BT065267.1 Zea mays full-length cDNA clone ZM_BFb0074N09 mRNA, complete cds.
GenBankBT0653520.0BT065352.1 Zea mays full-length cDNA clone ZM_BFb0114N22 mRNA, complete cds.
GenBankBT0865860.0BT086586.1 Zea mays full-length cDNA clone ZM_BFc0188G07 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813024.11e-179homeobox-leucine zipper protein HOX16-like isoform X1
SwissprotQ6YWR41e-141HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLA0A1E5WG540.0A0A1E5WG54_9POAL; Homeobox-leucine zipper protein HOX16
STRINGPavir.Aa00462.1.p1e-178(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-61homeobox 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]