PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 374aa    MW: 37943 Da    PI: 7.5927
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009449.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-3280133255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Do009449.1  80 PRMRWTTALHARFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 133
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.32E-1678134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-2978134IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2380133IPR006447Myb domain, plants
PfamPF002495.7E-881132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSTEPSTAPF AEGSGEVGFF ANPSPGAEPP GLSLGLGTAP AHGGDAAGRR GHLEPQGCAF  60
KRAASRASLP GGSKRSARAP RMRWTTALHA RFVHAVELLG GHERATPKSV LELMNVKDLT  120
LAHVKSHLQM YRTVKSTDRS LHIATGEALP LQRTATVMEA AAAAGGGAAA AAGGGVVVVP  180
VTAACDDIVG ICSSPSAGSA PPAAATTSAA HFLCAPPATA PLAVAPAPPP PIPPRTDHAA  240
AVLEKGVAAA VDSAHRCQKH NFSPPLLQDA QVTAMSGLID IWTVERERMV RTRGVQAFRS  300
VASLGASARQ VSMARSESDG SSSSEHKTCC DGVGAPGGVV VMDAAEKQAA ADGGAPEFVR  360
EDAFLSILVD CFGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1681135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1681135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1681135357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1681135357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo009449.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0651241e-116BT065124.1 Zea mays full-length cDNA clone ZM_BFb0205B22 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981643.11e-116probable transcription factor RL9
TrEMBLA0A1E5VYW70.0A0A1E5VYW7_9POAL; Putative transcription factor KAN4
STRINGSi036187m1e-116(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65543750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-37G2-like family protein