PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do007514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GeBP
Protein Properties Length: 239aa    MW: 25962 Da    PI: 6.4005
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do007514.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57337.37.7e-124534897
      DUF573 48 kvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                 +++ ql+eK+rrLK+Kf+  + +++ g +p+  ++hd+++++l++++W+
  Do007514.1  4 PYTRAQLSEKLRRLKNKFRSVSVRVAGGLDPARLAPHDRDVLHLCSRLWD 53
                57899********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.1E-10453IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MPQPYTRAQL SEKLRRLKNK FRSVSVRVAG GLDPARLAPH DRDVLHLCSR LWDPANAATS  60
PFAVSAGSSG NKRRRANPRG TQLPLPDASG DSNSHDYNGI ISSAPGLFPD GSNGEDMFYL  120
EQESGHLGDH QGAALVADSK FGVIVQEQPE TLAALPNGNN GIGNEMNGDQ KMVVPCSNEH  180
RMANAVLDVF EECLREAKAN GSAEESELAK RWRVQRMDEL DVLSRRLRLL VEDAAAAGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002464013.11e-148hypothetical protein SORBIDRAFT_01g010570
TrEMBLC5WNQ31e-148C5WNQ3_SORBI; Putative uncharacterized protein Sb01g010570
STRINGSb01g010570.11e-148(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243