PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 491aa    MW: 54015.6 Da    PI: 7.1637
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006813.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like673.2e-21206257355
     G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 r++W +eL e+F++av+ L G + AtP+ i++lm+v+gLt +h++SHLQk+Rl
  Do006813.1 206 RVQWIHELQEKFLDAVKVL-GDKYATPQGIRKLMNVNGLTSKHIASHLQKHRL 257
                 99*****************.99******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.131201260IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-20202261IPR009057Homeodomain-like
SuperFamilySSF466894.84E-13203261IPR009057Homeodomain-like
PfamPF002492.0E-5206256IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.2E-18206259IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MMPAGCGRQR AWRSVSGDSA AAARGFLQAA DVLACRPPLV RSTVFPFQTM VMALDFVNSR  60
AAMEEDLNLV LAEAHLHNIA PGFLANFELL HLILNELQVP LITMCAYDDV EAVSKLALGA  120
CFNLLKPLHT GSLNMLKTKA LEHKPRKATP QGPILSRTKS RMVSSPTKRP QEMLILERNN  180
LSNPESNEFQ VPEVRKAHGC SKKPDRVQWI HELQEKFLDA VKVLGDKYAT PQGIRKLMNV  240
NGLTSKHIAS HLQKHRLQQQ KAKQGGQNQM NASTKSVSEL IGLAHNAAIT ESIIPRVDAD  300
IEGVYPSRLW MHMSERPVTE AVASKTYTYT CTSGVYRDET KSVWDEYEKG LQEEFSASNR  360
HWQQIGLPSS KRKLPAKNNV VVIDRSVSSG APKAAGNNGN VEKINLLRGI EAASNNDSVG  420
NINLPEGPPD VREEEISRWM SLLEGSQDQP NLCLEDPMQV DITGNADIDG SMAQEATAQN  480
APVDDPVTLI A
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006813.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813472.11e-172two-component response regulator ARR2-like isoform X1
TrEMBLA0A1E5UYI00.0A0A1E5UYI0_9POAL; Uncharacterized protein
STRINGPavir.Db00207.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP130171928
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.11e-13response regulator 10