PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 757aa    MW: 82056.3 Da    PI: 6.3964
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006783.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.51.5e-15118169556
                 SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 +++t+ q e+Le +F  + +p++++r++LA+ +gL   qVk+WFqN+R+  k
  Do006783.1 118 HRLTSRQSEILEGFFSVCAHPDENQRRQLAATTGLGLHQVKFWFQNKRTHVK 169
                 5789********************************************9776 PP

2START88.21.7e-282744911206
                 HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG..CT-TT-S....EEEEEEE CS
       START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke..qWdetla....kaetlev 84 
                 e+a +aaqe++ + +a+ p+W  ++    e +n+  + q f+e+ +      ++ea ras+vv  ++   ve l+d +        ++     a+t++v
  Do006783.1 274 EVAKSAAQEVFILCDANGPLWLAVPggsyEVLNKIAYAQAFPEQISvgaigLKTEATRASAVVMLDAKSIVEYLMDAGSngT---FFPglmtTATTTKV 369
                 578899*********************999************9999********************************5552...44422224444444 PP

                 ECTT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
       START  85 issg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                  +           ga qlm+ el+ +sp vp R+ +f+Ry+++l++g+ ++vdvS+d  ++  +      +++ pSg li+p   + +kvt +ehv ++
  Do006783.1 370 YN-WpanpeagydGAMQLMTVELVYPSPQVPaRKCTFLRYCERLEQGVVAVVDVSLDDGAN--T------CRKMPSGVLIQPIRHNSCKVTAIEHVRVD 459
                 33.14677899**********************************************9999..3......89*************************** PP

                 SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                 ++  h+++++ ++ gl +ga++wv  + rqc++
  Do006783.1 460 DSDTHAMFQPCLN-GLLFGARRWVTSMARQCAR 491
                 **********996.899**************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-17100165IPR009057Homeodomain-like
SuperFamilySSF466893.76E-16107170IPR009057Homeodomain-like
PROSITE profilePS5007114.576111171IPR001356Homeobox domain
SMARTSM003892.9E-15111175IPR001356Homeobox domain
CDDcd000865.74E-14112170No hitNo description
PfamPF000463.8E-13118169IPR001356Homeobox domain
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
PROSITE profilePS5084818.404265494IPR002913START domain
CDDcd088757.14E-73270490No hitNo description
SuperFamilySSF559616.18E-16271491No hitNo description
PfamPF018521.0E-19274491IPR002913START domain
SMARTSM002345.0E-7274491IPR002913START domain
SuperFamilySSF559611.18E-7534714No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MGPASGIGNP SLMGSSGGTS DPSLMGSTDG ICDPSLMGST GGIGDGGLSP NMNATYEMNS  60
SNPFEELQAA NGLGQSPGGG ASRINEVDSS ILVSNNNGRE ESPGDGQEGS QRKKRCLHRL  120
TSRQSEILEG FFSVCAHPDE NQRRQLAATT GLGLHQVKFW FQNKRTHVKH LSGKEENYRL  180
RVENEMLREE NSRFRQAQSN GFCPGCSNDP AQLLIFKELE RLKLHNQLLQ QELQNRMNNE  240
TPMPMSSPPA RLFRLESSSE NFFAIQDDVQ ALTEVAKSAA QEVFILCDAN GPLWLAVPGG  300
SYEVLNKIAY AQAFPEQISV GAIGLKTEAT RASAVVMLDA KSIVEYLMDA GSNGTFFPGL  360
MTTATTTKVY NWPANPEAGY DGAMQLMTVE LVYPSPQVPA RKCTFLRYCE RLEQGVVAVV  420
DVSLDDGANT CRKMPSGVLI QPIRHNSCKV TAIEHVRVDD SDTHAMFQPC LNGLLFGARR  480
WVTSMARQCA RIRDVFHVTN CTLIVTSKGR KTIMKLADNL LANYTSSIAG IPVDAWSVQC  540
GDGTEQDVRI VYRKSDDTTN TAVVCASATF LLPLPMRIVF DMLKNNLLRV KWDVLVNGGC  600
VKDEVRVANG VGSEDAVSIL HVKHGSGANK ETTMVLQNSC YDASGAFMVY ASLDKHVMDM  660
ITSPDGEQAL SNIFLFPAGF FLVPLPDPVK GGAAIGEAGG TVMTAGFQIL MKLARGTGLC  720
PKSVSSAIKI MTENIATIKD TLMNSHPVFY NRNQSTN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006783.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025814677.10.0homeobox-leucine zipper protein TF1-like
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A1E5VMX00.0A0A1E5VMX0_9POAL; Homeobox-leucine zipper protein TF1
STRINGSi000488m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-117protodermal factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]