PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006742.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 265aa    MW: 27857.7 Da    PI: 8.6999
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006742.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.95.9e-403191262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++s
  Do006742.1 31 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRAS 91
                7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-292985IPR003851Zinc finger, Dof-type
PfamPF027012.4E-333289IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2273589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGSSSPSAEL IACPRPMPHP AAADRRLRPQ HDQPLKCPRC ESTHTKFCYY NNYSLSQPRY  60
FCKTCRRYWT KGGSLRNVPV GGGCRKNKRA SAKKPAAPPM LPAHARQVAE TGLHLSFSGM  120
QQLPPPPAAA DPLCSLGLLD WKYDPILAGS GCAAGALDGA SSEAHFAGAG MMGIPGGAEC  180
HALSALRYAA GLGEHLQLQG LPFGARAEHD AAEVKPAAAE RLLSLDWYGE ASRAPESAIS  240
SLGALGLWSG MIGGAHQHHG SSTAI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006742.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0353260.0BT035326.1 Zea mays full-length cDNA clone ZM_BFb0055G17 mRNA, complete cds.
GenBankBT0629570.0BT062957.1 Zea mays full-length cDNA clone ZM_BFc0012J21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953626.11e-164dof zinc finger protein 1
TrEMBLA0A1E5W9880.0A0A1E5W988_9POAL; Dof zinc finger protein DOF5.6
STRINGSi017962m1e-164(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.13e-38Dof family protein