PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006395.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 312aa    MW: 34618.4 Da    PI: 8.3222
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006395.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.94e-124569125
     G2-like  1 kprlrWtpeLHerFveaveqLGGse 25
                k+rlrWt++LH+rFv+a++qLGG++
  Do006395.1 45 KQRLRWTSDLHNRFVDAIAQLGGPD 69
                79*********************98 PP

2G2-like49.41e-151171472555
     G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +AtPk +l +m+v+g+t++hvkSHLQkYRl
  Do006395.1 117 SRATPKGVLTVMGVPGITIYHVKSHLQKYRL 147
                 69****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-274370IPR009057Homeodomain-like
TIGRFAMsTIGR015576.9E-84570IPR006447Myb domain, plants
SuperFamilySSF466898.24E-7110147IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-11117148IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-27119148IPR009057Homeodomain-like
PfamPF143791.1E-23180225IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MMYHAKNFSV PFAPQRAQNN EHASNIGAIG GSNISNPANP VGSGKQRLRW TSDLHNRFVD  60
AIAQLGGPDS GYSILCRVLV IVVELDALHK LSSARIFCID GITMKKLNLA KYWLHISRAT  120
PKGVLTVMGV PGITIYHVKS HLQKYRLAKY IPESPAEGSK DEKKDSSDSL SNTDSAPGLQ  180
INEALKMQME VQKRLHEQLE VQRQLQLRIE AQGRYLQMII EEQQKLGGSI KASEDQKVSH  240
SPPSLDEYPE STQPSPKKPR IDALSPDSER DTTQPEFESH LIGPWDQEIC GKNICGVAFP  300
VEFKADPGRS KS
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006395.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9752610.0EU975261.1 Zea mays clone 485946 MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961661.10.0myb family transcription factor PHL7
TrEMBLA0A1E5V7A30.0A0A1E5V7A3_9POAL; Myb family transcription factor PHL7
STRINGSi022972m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-43G2-like family protein