PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 233aa    MW: 26113.8 Da    PI: 4.4571
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006082.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.4e-203790356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  Do006082.1 37 KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 90
                56789************************************************9 PP

2HD-ZIP_I/II133.19.9e-4336128193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl++eqv+lLE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+dy++Lk+aydal+++++ L +++++Lr+++++
   Do006082.1  36 EKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETDYDRLKAAYDALAADHQGLLADNDSLRAQVNS 128
                  69***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.2043292IPR001356Homeobox domain
SuperFamilySSF466892.42E-193294IPR009057Homeodomain-like
SMARTSM003896.9E-193596IPR001356Homeobox domain
CDDcd000868.64E-183793No hitNo description
PfamPF000462.7E-173790IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-213899IPR009057Homeodomain-like
PRINTSPR000313.4E-66372IPR000047Helix-turn-helix motif
PROSITE patternPS0002706790IPR017970Homeobox, conserved site
PRINTSPR000313.4E-67288IPR000047Helix-turn-helix motif
PfamPF021831.0E-1692134IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAVLGMDDAA RVGKRPFFTT HEELLEEEYY DEQAPEKKRR LTAEQVQLLE RSFEEENKLE  60
PERKTELARR LGMAPRQVAV WFQNRRARWK TKQLETDYDR LKAAYDALAA DHQGLLADND  120
SLRAQVNSLT EKLQGKETSP SATTTAQEVD QQDEHTAASG TEKLLAQQLK DGLLSSGDCN  180
GHGALSSEEE DGGVISDEGC SFDLPDAMLT AIGVTHHGAE EAQLCNWTSW FWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18492RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006082.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9597010.0EU959701.1 Zea mays clone 219449 homeodomain leucine zipper protein CPHB-5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973433.11e-152homeobox-leucine zipper protein HOX5
SwissprotQ6ZA742e-98HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
TrEMBLA0A1E5V1D21e-171A0A1E5V1D2_9POAL; Homeobox-leucine zipper protein HOX5
STRINGSi014228m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.14e-55homeobox 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]