PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do006040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 224aa    MW: 24439.1 Da    PI: 9.8833
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do006040.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.6e-18121175256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++t  q   Le+ F+ ++ +s+ e++eLA+++gL+ rqV vWFqNrRa+ k
  Do006040.1 121 RKKLRLTGVQAAMLEDSFRAHNILSHGEKQELARRVGLSARQVEVWFQNRRARAK 175
                 67788999*********************************************98 PP

2HD-ZIP_I/II109.13.2e-35121209189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+  q+++LE+sF++++ L++ +K+elar++gl++rqv+vWFqnrRAR k+kq+E d++ L+r++d+l++en++L+++ ++Lr+
   Do006040.1 121 RKKLRLTGVQAAMLEDSFRAHNILSHGEKQELARRVGLSARQVEVWFQNRRARAKLKQTEIDCDLLRRWCDRLTDENASLRRDLADLRR 209
                  69************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.617117177IPR001356Homeobox domain
SMARTSM003897.7E-15119181IPR001356Homeobox domain
SuperFamilySSF466894.18E-18119186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-17121175IPR009057Homeodomain-like
PfamPF000461.3E-15121175IPR001356Homeobox domain
CDDcd000869.00E-13121178No hitNo description
PRINTSPR000311.9E-6148157IPR000047Helix-turn-helix motif
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PRINTSPR000311.9E-6157173IPR000047Helix-turn-helix motif
PfamPF021836.8E-7177208IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.8E-10177218IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSSLTTAGST EEHYSVSAEE FGTHLSLGLG GGGGSSRPPR TVQLFGEVLS LQDDDGHDGA  60
RARYREPTVS LESRRKRYHG GSGGAAVVVA SRQNKKARKS QLGTDDDDGD CQSPTSDGGG  120
RKKLRLTGVQ AAMLEDSFRA HNILSHGEKQ ELARRVGLSA RQVEVWFQNR RARAKLKQTE  180
IDCDLLRRWC DRLTDENASL RRDLADLRRA SARLAVSPPA PTIS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177RRARAKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo006040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951890.11e-86putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX66e-45HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLA0A1E5WBP51e-160A0A1E5WBP5_9POAL; Putative homeobox-leucine zipper protein HOX26 (Fragment)
STRINGPavir.Aa03244.1.p1e-93(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-31homeobox protein 2