PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 531aa    MW: 61072.9 Da    PI: 9.3496
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004998.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54872151128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv++yLk+k++g k+el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++vl+++g
  Do004998.1  87 LPPGFRFHPTDEELVNYYLKRKIHGLKIEL-DIIPEVDLYKCEPWELAdKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVLHHGG 184
                 79****************************.99**************85335566888***************************************** PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +g+kktLv+y+grap+g++tdWvmheyrl
  Do004998.1 185 RPIGMKKTLVYYRGRAPQGVRTDWVMHEYRL 215
                 *****************************98 PP

2NAM171.33.1e-533194461128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v   ++
  Do004998.1 319 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGCRTNRATQAGYWKSTGKDRRVNY-QN 415
                 79****************************.99**************84335556888*************************************9.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +g+kktLv+ykgrap+g +t+Wvmheyr+
  Do004998.1 416 RPIGMKKTLVYYKGRAPQGLRTNWVMHEYRI 446
                 9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.94E-6579238IPR003441NAC domain
PROSITE profilePS5100560.25187238IPR003441NAC domain
PfamPF023655.0E-2988215IPR003441NAC domain
SuperFamilySSF1019414.45E-63311469IPR003441NAC domain
PROSITE profilePS5100559.261319469IPR003441NAC domain
PfamPF023654.5E-29320446IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MEPVEKRVKL ARARESGKET TKGGHPIAQN RIDRSIDRRC AGVGSRQPPH PASRLIDRSL  60
AGRRQHISVR RRSSAPTVQA SMAPVGLPPG FRFHPTDEEL VNYYLKRKIH GLKIELDIIP  120
EVDLYKCEPW ELADKSFLPS RDPEWYFFGP RDRKYPNGFR TNRATRAGYW KSTGKDRRVL  180
HHGGRPIGMK KTLVYYRGRA PQGVRTDWVM HEYRLDDKDA EDTLPIQDTY ALCRVFKKNA  240
ICTEVDDLQA QCSMALLEGA CQQLLTSGSQ EYQTPSPDAL NHFTEELKST VAGDGRERQR  300
ERSARKEAAS WEAMAPADLP PGFRFHPTDE ELVNYYLKRK VHGLSIELDI IPEVDLYKCE  360
PWELAEKSFL PSRDPEWYFF GPRDRKYPNG CRTNRATQAG YWKSTGKDRR VNYQNRPIGM  420
KKTLVYYKGR APQGLRTNWV MHEYRIEESE CENTMGIQDS YALCRVFKKN VAFGDFQKQK  480
EGECSSSQAK GKQEQFTNVG DAGQSSGSNE HGKDNSWMQF IADDLWCNKT K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-518246910167NAC domain-containing protein 19
4dul_A1e-518246910167NAC domain-containing protein 19
1ut7_B1e-518246910167NO APICAL MERISTEM PROTEIN
1ut7_A1e-518246910167NO APICAL MERISTEM PROTEIN
1ut4_B1e-518246910167NO APICAL MERISTEM PROTEIN
1ut4_A1e-518246910167NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280590.0KJ728059.1 Zea mays clone pUT6205 NAC transcription factor (NAC121) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957583.11e-155PREDICTED: NAC domain-containing protein 86-like
SwissprotA4VCM01e-83NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A0E0M4A40.0A0A0E0M4A4_ORYPU; Uncharacterized protein
STRINGSi033085m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-104NAC domain containing protein 57