PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004946.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 482aa    MW: 51551.4 Da    PI: 6.3219
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004946.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.11.9e-104664421374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                 lv+lL++c  a+++gd + a+  La+ + +  +    + + R+a +ft ALa+rl+   ++ +   pp +      +  ++ ++ f+++sP+lkf+++t
  Do004946.1  66 LVHLLVTCTGAIQAGDYTGAHGNLAEARAIltVIAPSTGIGRVANHFTDALAQRLFPAYPHSA---PPPPP----PAAPAKLYSQFYDASPYLKFAYFT 157
                 68***************************9533344499*****************9333332...33333....4667888999************** PP

        GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 aNqaIl+a+eg++ vH++Df ++qGlQWp+L++aL++R++gpp+lR+Tg+g++ +g  +el+e+g rL +fA+ l+vpf+f+ + a++l+ l+   L++
  Do004946.1 158 ANQAILDAFEGCDSVHVVDFALMQGLQWPTLIHALSQREGGPPRLRVTGIGPHPTGAGDELREVGFRLGEFARYLNVPFSFERVCADQLDGLSKYWLKI 256
                 ****************************************************9999******************************************* PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl..eaklpreseerikvErell 290
                  pgEala+n++lqlhrll ++ + +    ++d +L+lv +l+P+v++vveqe dhn++++lerf++al yy+a+fds+  e + +    + + + +++l
  Do004946.1 257 IPGEALAINSILQLHRLLVDPDADPAvpaPIDILLDLVTELQPTVFTVVEQEGDHNKSPLLERFTNALFYYAAMFDSMggEGNHAGGGGATNLLAEAYL 355
                 *****************96655544444499***********************************************75555555569999999**** PP

        GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl.llrkvk..sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + ei ++v+ eg++r+erhe l++Wrerl++aG+ +vp++ ++a  a + l++ ++  + gy + e +gsl l W+drpL++++aWr
  Do004946.1 356 RAEIFDIVCGEGSARTERHELLGRWRERLTRAGLAQVPFGLNEARLATAqLVHATSftGSGYDILECDGSLALAWHDRPLYVATAWR 442
                 **************************************99776665554155544434677*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098553.42240419IPR005202Transcription factor GRAS
PfamPF035146.6E-10266442IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MDPAAAASLT GSIPPPYPTA AINGAAYCIN PALFVSLQPP SRPPSVPTAA EAVRRRQVEE  60
DAAIRLVHLL VTCTGAIQAG DYTGAHGNLA EARAILTVIA PSTGIGRVAN HFTDALAQRL  120
FPAYPHSAPP PPPPAAPAKL YSQFYDASPY LKFAYFTANQ AILDAFEGCD SVHVVDFALM  180
QGLQWPTLIH ALSQREGGPP RLRVTGIGPH PTGAGDELRE VGFRLGEFAR YLNVPFSFER  240
VCADQLDGLS KYWLKIIPGE ALAINSILQL HRLLVDPDAD PAVPAPIDIL LDLVTELQPT  300
VFTVVEQEGD HNKSPLLERF TNALFYYAAM FDSMGGEGNH AGGGGATNLL AEAYLRAEIF  360
DIVCGEGSAR TERHELLGRW RERLTRAGLA QVPFGLNEAR LATAQLVHAT SFTGSGYDIL  420
ECDGSLALAW HDRPLYVATA WRAAGGSIVG AVAGTEGRNY GRRRKARNGS RGSNSFGNLA  480
LA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-45664424375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963578.10.0PREDICTED: DELLA protein DWARF8-like
TrEMBLK3ZCZ80.0K3ZCZ8_SETIT; Uncharacterized protein
STRINGSi024429m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-79GRAS family protein