PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 250aa    MW: 25037.1 Da    PI: 10.5021
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004796.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.11.2e-303083155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Do004796.1 30 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 83
                59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.06E-202787IPR009057Homeodomain-like
PROSITE profilePS5129411.0592786IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-312988IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-243183IPR006447Myb domain, plants
PfamPF002498.5E-83382IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MNGGGASSAA GSSGGGGGGA GDEPARTLKR PRLVWTPQLH KRFVDAVAHL GIKNAVPKTI  60
MQLMSVDGLT RENVASHLQK YRLYLKRMQG LGGGGGGGGG GGGGAGGSHS SGSGTDAATE  120
HLFATGPVPF LPPAHRAPAG ADPYPPFAPM GAAHHHHAPQ IGHFHHHPAA RPLGHYAAAG  180
AGFDHGFLSR TGAPPVGPPG MHHHRMVGAG GGMGMMAPAS FADEMDLGSR GGGAGTGRRE  240
LTLFPTSGDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-343086157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo004796.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0865880.0BT086588.1 Zea mays full-length cDNA clone ZM_BFc0188H07 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310197.11e-104uncharacterized protein LOC107548110
SwissprotO222101e-45MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A1E5WG621e-171A0A1E5WG62_9POAL; Transcription factor LUX
STRINGGRMZM2G471600_P011e-104(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-44G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]