PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004303.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 512aa    MW: 56408.4 Da    PI: 7.4987
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004303.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox44.52.7e-1466117657
                 S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 ++t++q+eeL +++ ++ +p+a++ e L +k gL  + Vk+WFqNrR+k+ k
  Do004303.1  66 RHTPQQIEELIAAYDQCTHPDAKTQEALGTKNGLAPKLVKFWFQNRRTKMQK 117
                 589**********************************************976 PP

2START73.36.3e-242173844167
                 HHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTTEEEEEE CS
       START   4 eeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetlakaetlevissggalqlm 94 
                  e +++++ +a+ +ep+W      e++n+ e+  + ++  +      + +e+ r++++v + +a+lv +l+d++ +W++t++   +++ +  g    +m
  Do004303.1 217 AESMEQFLMLATKGEPMWQITTngEMLNYVEYGARMSPCLFgfcpkgFVVEVTRDTAMVWGSAADLVGILMDTA-RWSKTFP--GVVASVVAG---DVM 309
                 68999*****************99999999999999887669999999**************************.*******..444444444...589 PP

                 EEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
       START  95 vaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwv 167
                 +a+l + sp vp R + ++R+++  ++ +w+++dvSvd    ++   s ++ ++llpSg+lie++sngh+k +++
  Do004303.1 310 NAKLWVQSPRVPnRTVNILRFSKLITERKWAVMDVSVDGILGQQVmPSRYMGCRLLPSGCLIEDMSNGHCKSIYI 384
                 **************************************8777777789***********************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-1351118IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-1457121IPR009057Homeodomain-like
PROSITE profilePS5007112.42258118IPR001356Homeobox domain
SMARTSM003891.5E-961122IPR001356Homeobox domain
CDDcd000861.33E-966118No hitNo description
PfamPF000468.0E-1266117IPR001356Homeobox domain
PROSITE profilePS5084813.969205384IPR002913START domain
SuperFamilySSF559612.06E-12215384No hitNo description
PfamPF018521.0E-16217384IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MEKGGQQISE NGHDLDLTLG NDPSHQLRNN HEDATDDFLG DEGYAYTDPE DEDYVPGRKG  60
STRVKRHTPQ QIEELIAAYD QCTHPDAKTQ EALGTKNGLA PKLVKFWFQN RRTKMQKKAQ  120
LEQNKHIQQE NISLLTANQL FRQAMLTQSC ITCGSGTLRF NPSLEKQRLL IENARLKDEY  180
LRASTADNKI IRASAFTQPA PWIISGRADH EALTLHAESM EQFLMLATKG EPMWQITTNG  240
EMLNYVEYGA RMSPCLFGFC PKGFVVEVTR DTAMVWGSAA DLVGILMDTA RWSKTFPGVV  300
ASVVAGDVMN AKLWVQSPRV PNRTVNILRF SKLITERKWA VMDVSVDGIL GQQVMPSRYM  360
GCRLLPSGCL IEDMSNGHCK SIYIPGHMDN GLCMRKAGGT LKLAQQMMVS FYTAVSGPVT  420
TQTQAMSSIL EWFGSMGTGV ERRRTDASGS LVVYAPIGEE TMNAAIDGGA SVVFLPSGFA  480
ILPDGHSKAR RALVTAPSTS SAPVCRNNGV LF
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo004303.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025801379.10.0homeobox-leucine zipper protein ROC6-like
TrEMBLA0A1E5V0Z20.0A0A1E5V0Z2_9POAL; Homeobox-leucine zipper protein ROC7
STRINGSi032393m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.21e-56HD-ZIP family protein