PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do004163.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 150aa    MW: 15888.7 Da    PI: 8.9354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do004163.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like377.5e-12105136233
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktil 33 
                 pr+rWt+ LH++Fv+ave LGG+e +   ti 
  Do004163.1 105 PRMRWTTALHAHFVHAVELLGGHESTFKNTIA 136
                 9**********************987666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-9102133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MAATAAAPDL SLHISPPSPP DAGSSGGDGE AYHETEGFFA KPKLCLGLET AAAQQDGQCD  60
IQQQRLHQPI SQIQRFKNNS SAALSGGTTR SRNGSSGGKR SSRAPRMRWT TALHAHFVHA  120
VELLGGHEST FKNTIASIVF TSCSVKLFIN
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo004163.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982402.16e-61uncharacterized protein LOC101779847
TrEMBLA0A1E5WJR71e-107A0A1E5WJR7_9POAL; Uncharacterized protein
STRINGPavir.Ia01264.1.p7e-52(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.29e-12G2-like family protein