PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 418aa    MW: 45542.6 Da    PI: 7.1116
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003706.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like61.71.4e-1957109155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r++Wt eL e+F++a + L G e A+Pk+il lm+v+g+++e+v+SHLQk+R+
  Do003706.1  57 KQRIVWTDELKEKFLKAYHIL-G-EGAVPKKILALMNVHGISRENVASHLQKHRM 109
                 79*******************.4.67****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.99E-1555113IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2055113IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-1857109IPR006447Myb domain, plants
PfamPF002491.5E-661108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MAPEATGDGT GSSAMEAATQ KNRKRKKLEA AQQKNKPRKR KKVSLSSSSA AEPATRKQRI  60
VWTDELKEKF LKAYHILGEG AVPKKILALM NVHGISRENV ASHLQKHRMS LKREEQCIPD  120
KGDERALHAE ASSQTPLHSL HHPPSQAPAA SSSLYPLPPQ SPFMAHLDMM SPLQIVGHGQ  180
QLLQTPLDCF ISNNDAATNL LLPMVQPIQQ RTTPPEATAI ATNHCQGPDM EAFQGVSLTG  240
ESSVPEANMR YEEAEIRMAQ LQMAAKAEEG QAAAASAAGS LSPYWKQLLQ KPLDCYSNND  300
AATNLLLPMV QPIQQRITPP LQATTGATMQ KLVETRESSV VPEANMRYEE AEIRMAQLQM  360
AAKAEAEMGQ GRAAESGAAA AGSLSPPGSS IIERFWKSDD IVVSWDFSDF SAWSYKTD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-1454113262ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12441RKKLEAAQQKNKPRKRKK
23741RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo003706.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819305.16e-62probable transcription factor GLK2
TrEMBLA0A1E5VCD60.0A0A1E5VCD6_9POAL; Uncharacterized protein
STRINGSi004864m7e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2096956
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-16response regulator 12