PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 282aa    MW: 30015.8 Da    PI: 8.2231
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003629.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.3e-18119173256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Do003629.1 119 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTK 173
                 788899***********************************************98 PP

2HD-ZIP_I/II1253.4e-40119208191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rl+keq++lLE+ F+e+++L+p++Kv+la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l+een+rL++e +eLr +l
   Do003629.1 119 RKKLRLTKEQSALLEDRFKEHSTLNPKQKVALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKRCCESLTEENRRLQRELQELR-AL 208
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-19114176IPR009057Homeodomain-like
PROSITE profilePS5007117.232115175IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.2E-18115178IPR009057Homeodomain-like
SMARTSM003897.8E-16117179IPR001356Homeobox domain
PfamPF000461.9E-15119173IPR001356Homeobox domain
CDDcd000867.94E-15119176No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
SMARTSM003403.0E-24175218IPR003106Leucine zipper, homeobox-associated
PfamPF021837.6E-11175209IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MAQEDVHLDD AGLALGLSLG GGGTASEAAR QSTSRRLSRE ARLPSPLALE PSLTLSMPDE  60
ATATGSGGCG GGAHSVSSLS VAGVKRERAE EADGERASST AAAARACAGA EDDDDGSTRK  120
KLRLTKEQSA LLEDRFKEHS TLNPKQKVAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD  180
CELLKRCCES LTEENRRLQR ELQELRALKF APPPAPQPSA ATPATAAVPA PFYMQLPAAT  240
LTLCPSCERL GGPAAAAKAD PDRPKAATTH HFFNPFTHSA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123TRKKLRL
2167175RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo003629.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0357540.0BT035754.2 Zea mays full-length cDNA clone ZM_BFb0081O05 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797739.11e-128homeobox-leucine zipper protein HOX19-like isoform X2
SwissprotA2XE761e-112HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL41e-112HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A1E5UYT50.0A0A1E5UYT5_9POAL; Homeobox-leucine zipper protein HOX19
STRINGGRMZM2G126808_P021e-125(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-52homeobox from Arabidopsis thaliana