PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003611.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 285aa    MW: 32068 Da    PI: 5.2783
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003611.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.7e-51141391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtdeelv +yL+++++g++ ++  +i+evd+y+++PwdLp+++  +++ewyfF++rd+ky++g+r+nr + sgyWkatg dk+v + +g++
  Do003611.1  14 LPPGFRFHPTDEELVAHYLCPRAAGRRPPV-PIIAEVDLYRFDPWDLPERALFGRREWYFFTPRDRKYPNGSRPNRGAGSGYWKATGADKPVEH-GGRT 110
                 79*************************999.88***************87778999********************99***************9.9*** PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kk Lvfy+g+ p+g+kt+W+mheyrl
  Do003611.1 111 VGIKKALVFYHGKPPRGVKTEWIMHEYRL 139
                 ***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-6410169IPR003441NAC domain
PROSITE profilePS5100559.81914169IPR003441NAC domain
PfamPF023658.6E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAQRRDDAEA ALNLPPGFRF HPTDEELVAH YLCPRAAGRR PPVPIIAEVD LYRFDPWDLP  60
ERALFGRREW YFFTPRDRKY PNGSRPNRGA GSGYWKATGA DKPVEHGGRT VGIKKALVFY  120
HGKPPRGVKT EWIMHEYRLP EAGARGGKRS GNGGSLRLDD WVLCRLYHKK NEWEKMQGKK  180
DKAAMDSEVS LTHSHADTRT PESEIDDDTF PELGSLPALD EMAPAPAGAV LPKEEVLEEF  240
DNLGGDDWLE GINLDDLQMP GDADYFGNML ATPKPEQDGG FFPFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-9311751174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459566.11e-165hypothetical protein SORBIDRAFT_02g006680
SwissprotQ7EZT11e-115NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLC5XDE91e-165C5XDE9_SORBI; Putative uncharacterized protein Sb02g006680
STRINGSb02g006680.11e-165(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-76NAC family protein