PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 292aa    MW: 32891.1 Da    PI: 7.9371
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003574.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.96e-5161371128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee.....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                 lppGfrFhP+d+elv +yL++k+ g     +   +     ++ +vd++kvePwdLp  +  + kewyf+s rd+kyatg+r+nrat+sgyWkatgkd++
  Do003574.1   6 LPPGFRFHPRDDELVLDYLARKLGGGGavvV---SiygcpTMVDVDLNKVEPWDLPDIACIGGKEWYFYSLRDRKYATGQRTNRATDSGYWKATGKDRP 101
                 79***********************996552...334454699*************6555689************************************ PP

         NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 + + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r+
  Do003574.1 102 ISR-KGLLVGMRKTLVFYQGRAPKGKKTEWVMHEFRM 137
                 *99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-593160IPR003441NAC domain
PROSITE profilePS5100555.8226160IPR003441NAC domain
PfamPF023652.3E-257137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVEAKLPPGF RFHPRDDELV LDYLARKLGG GGAVVVSIYG CPTMVDVDLN KVEPWDLPDI  60
ACIGGKEWYF YSLRDRKYAT GQRTNRATDS GYWKATGKDR PISRKGLLVG MRKTLVFYQG  120
RAPKGKKTEW VMHEFRMEGQ GDPMKLPFKE DWVLCRVFYK SRATIAKPPA ESSSYNIDAA  180
TTSLPPLIDN YNISFDQPGS SVQNLEGYEQ VPCFSNNPSH QPSSSMNAPL SSAMADQEQH  240
MGKSIRDVLM SQFSRFDGSV KRETPPQSNF SQDGFEYLAE SGFTQMWNSF NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-51216111169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0655120.0BT065512.1 Zea mays full-length cDNA clone ZM_BFb0202I06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966196.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE67e-87NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLK3XYG70.0K3XYG7_SETIT; Uncharacterized protein
STRINGSi006975m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.24e-88NAC domain containing protein 1