PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do003247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 396aa    MW: 41974.5 Da    PI: 7.0221
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do003247.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.79.7e-53111391128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ +
  Do003247.1  11 VPPGFRFHPTEEELLNYYLRKKVASQQIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYN-S 107
                 69****************************.9***************952444443456**************************************.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g++ktLvfykgrap+g+k+dW+mheyrl
  Do003247.1 108 VKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                 899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-587175IPR003441NAC domain
PROSITE profilePS5100556.5611175IPR003441NAC domain
PfamPF023654.1E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQQIDL DVIRDVDLNK LEPWDIQEKC  60
KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNSVKR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DPTASGDAAA TVTAAAASSD AGQEDGWVVC RVFKKKHHHK  180
ESGGGSGGKH GSGGGGDGGK AAATVHHGLH YSSSDDALDQ ILQYMGRSCK QEHEQLLSPH  240
GGSGGGAGRA GPRYLRPIDT VLDRHGFMKL PPLESPSATA TLTPPHLSAA GDAAATAAGD  300
DLLHGGGNGI TDWAMMDRLV ASHLNGQAPD AATAADQLCF DGGAEDADGL AFYSAAATRL  360
LGGGGGSSDD DLWSFTRSSA PAAATSTTER LSHVSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-48817614166NAC domain-containing protein 19
4dul_A4e-48817614166NAC domain-containing protein 19
1ut7_B4e-48817614166NO APICAL MERISTEM PROTEIN
1ut7_A4e-48817614166NO APICAL MERISTEM PROTEIN
1ut4_B4e-48817614166NO APICAL MERISTEM PROTEIN
1ut4_A4e-48817614166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186194GGKHGSGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750810.0KT075081.1 Panicum virgatum secondary wall NAC master switch (SWN2A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140582.10.0secondary wall NAC transcription factor 2
SwissprotQ84WP61e-125NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A0K1TPD10.0A0A0K1TPD1_PANVG; Secondary wall NAC master switch
STRINGMLOC_66924.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.19e-97NAC family protein