PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 850aa    MW: 97069.3 Da    PI: 8.9697
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002520.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.65.8e-942355821350
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA+avs ++++la+ +L+ +++++s +gd +qRla++++e L+arla+++ +l+++l +++ +    +  l++++l   + P+l+  h   N
  Do002520.1 235 LRTLLIHCAQAVSVNNQTLASDILNIIRQNCSISGDGTQRLASCLVECLEARLAGTGGQLFQKLVSKSRN---AVGILKVYQLCLAANPFLRAFHYFSN 330
                 6789*********************************************************999998887...99************************ PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                 ++Il+  +g+ +vHiiDf+i +G+QWp+L++++a+R++gpp++RiTg+++p++g    ++  +tg+rLa++A+ ++vpfe++ ++++++e++ +e++++
  Do002520.1 331 KTILDVSKGKPKVHIIDFGICYGFQWPSLFEQFAKREDGPPKVRITGIEHPQPGfrPDQMNTHTGQRLADYASMFNVPFEYRGILSSKWETIPIEDFHI 429
                 *******************************************************88888899************************************ PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 + +++l+Vn+ +++++l de+vs++s+r++vL++++ ++Pkv+++   + +++++ Fl+rf e +++ysa fd l++++pr++e+r+ vEr + + ++ 
  Do002520.1 430 EGDDVLIVNCLYRMKNLGDETVSVNSARNRVLNTIRMMNPKVFIHGVVNGSYSTPYFLTRFKEVMYHYSASFDILDKTIPRDNEARMIVERDIYRCALL 528
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                 nv+aceg++r+er e+++kW++r  +aG+++++l+ +++k  + ++ ++++d y 
  Do002520.1 529 NVIACEGSDRIERPESYKKWKSRNLKAGLEQLQLNPDIVKVTRDMVGQYHKD-YV 582
                 *************************************************966.65 PP

2GRAS224.64.9e-6959183271311
        GRAS  71 eknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLak 167
                 ++n++  l++++l   ++P+++  +  aN++I + ++g+ rvHi+Df+i  G+QWp+L+++La+R++gpp++RiTg+++p++g   +e++++ g+rLa+
  Do002520.1 591 RRNVAGILKVFHLCMAICPFMRAPYYFANKTIIDVTKGKPRVHIVDFGICFGFQWPSLFEQLAKREGGPPKVRITGIDQPQPGfrPNESTKNAGQRLAD 689
                 45578889999999************************************************************************************* PP

        GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                 +A+ ++vpfe++  +++++e++++e+++++++++l+Vn++++l++l de++s++s+r++vL++++ ++P v+v+   + +++++ Fl+rf e ++ ysa
  Do002520.1 690 YARMFNVPFEYQG-ISSKWETIKIEDFNIEQDDVLIVNCIYRLKNLGDETLSINSARNRVLNTIRMMKPIVFVHGVMNGSYSTPFFLTRFKEVMYNYSA 787
                 *************.7************************************************************************************ PP

        GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhet 311
                 lfd l++++pr++e r+ +Er +    i nv+ac+g+er++r ++
  Do002520.1 788 LFDILDKTVPRDNEIRMILERDIYLSVILNVIACKGSERIARGQR 832
                 ****************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.86209587IPR005202Transcription factor GRAS
PfamPF035142.0E-91235582IPR005202Transcription factor GRAS
PfamPF035141.7E-66591832IPR005202Transcription factor GRAS
PROSITE profilePS5098539.22597850IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 850 aa     Download sequence    Send to blast
MQEDSDDKVK LHHGECALRA MEEPFYRLLG QNSPPYPEVL SLCSCDNLNN LDGCINKSSG  60
QSCSSCSIAH DSCNHHSNHK LQPFEAPWSL SDIVKETKHF TQATPNMELG LNVDGLSIAE  120
KRSRDYQSLQ VNVAYTSKQA SSEVQCQNYP RTEDFYLLEG RSSKQLAISF SGPTRDEMFD  180
KVLLFSEHKP MDEGIVLQEM MTNKSTRISQ NDQGRISARQ KTRGKKQQKK EVVDLRTLLI  240
HCAQAVSVNN QTLASDILNI IRQNCSISGD GTQRLASCLV ECLEARLAGT GGQLFQKLVS  300
KSRNAVGILK VYQLCLAANP FLRAFHYFSN KTILDVSKGK PKVHIIDFGI CYGFQWPSLF  360
EQFAKREDGP PKVRITGIEH PQPGFRPDQM NTHTGQRLAD YASMFNVPFE YRGILSSKWE  420
TIPIEDFHIE GDDVLIVNCL YRMKNLGDET VSVNSARNRV LNTIRMMNPK VFIHGVVNGS  480
YSTPYFLTRF KEVMYHYSAS FDILDKTIPR DNEARMIVER DIYRCALLNV IACEGSDRIE  540
RPESYKKWKS RNLKAGLEQL QLNPDIVKVT RDMVGQYHKD YVLYRKLMAK RRNVAGILKV  600
FHLCMAICPF MRAPYYFANK TIIDVTKGKP RVHIVDFGIC FGFQWPSLFE QLAKREGGPP  660
KVRITGIDQP QPGFRPNEST KNAGQRLADY ARMFNVPFEY QGISSKWETI KIEDFNIEQD  720
DVLIVNCIYR LKNLGDETLS INSARNRVLN TIRMMKPIVF VHGVMNGSYS TPFFLTRFKE  780
VMYNYSALFD ILDKTVPRDN EIRMILERDI YLSVILNVIA CKGSERIARG QRVTRNGSYE  840
TKRRALSSSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-352398418329GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665058.10.0PREDICTED: scarecrow-like protein 34 isoform X2
TrEMBLK4AMS50.0K4AMS5_SETIT; Uncharacterized protein
STRINGSi040221m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117882640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-127GRAS family protein