PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 318aa    MW: 35670.3 Da    PI: 7.9157
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002449.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.97.2e-18855149
         NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                + pGfrFhPtdeelv +yLk+k+++k+l++ e i+++diyk++PwdLp+
  Do002449.1  8 MLPGFRFHPTDEELVRFYLKRKIQQKSLPI-ELIRQLDIYKYDPWDLPS 55
                579***************************.89**************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-247104IPR003441NAC domain
PROSITE profilePS5100516.3568162IPR003441NAC domain
PfamPF023651.3E-71051IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEKQDEVMLP GFRFHPTDEE LVRFYLKRKI QQKSLPIELI RQLDIYKYDP WDLPSRAAKG  60
VKTDWMMHXF RLPSLTDPSL PPKKPLEKTI PPNDSWAICR IFKKTNSTAQ RALSHSWVSP  120
PLSSTNENYI RPSSQVTQRS QHSSEKTSST MTDIISSTIQ FTGSSYMPSI VSSCRNPLSI  180
IDSSSSRPAA SLVLPPSNAE HQTMSVLSAI PLDLPAGMDA TSMVLNASPT TLQNLDRIPT  240
NIEFSQPHHP NNSIIMASRC TVDLPDIGNS ANSAPRLINF PFNLQGALPD DWRMTLPWDF  300
LPCTTEVSTN YQSTKCFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-1510621769Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1964720.0AC196472.3 Zea mays BAC clone ZMMBBb-235B12 from chromosome 5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660941.11e-173PREDICTED: LOW QUALITY PROTEIN: putative NAC domain-containing protein 94
TrEMBLK3YYF71e-173K3YYF7_SETIT; Uncharacterized protein
STRINGSi019308m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137172629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.14e-27NAC domain containing protein 94