PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002375.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 782aa    MW: 84229.2 Da    PI: 6.0296
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002375.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-20100156157
                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Do002375.1 100 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 156
                 688999************************************************995 PP

2START186.81.1e-583005172206
                 HHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEEEECTT.. CS
       START   2 laeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakaetlevissg.. 88 
                 la +a++el+ +a +++p+W +     +++++e+ + f+ + +      + ea+r+ +vv+m+   lve+l+d ++    ++  + +a+t+ev+s+g  
  Do002375.1 300 LAVAAMDELLGMARVDAPLWGSGTagAQLDEEEYGRMFPGGLGprqfgLRPEASRDGAVVIMTRDSLVEILMDANRfaaVFSSIVSRASTHEVLSTGva 398
                 6789******************99999***********6655599999999************************88888888888************* PP

                 ....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHH CS
       START  89 ....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllr 182
                     galq+m++e+q++splvp R+ +f+Ry++  ++g+wv+vdvS+ds ++ p    v +++++pSg+li++++ng+skvtwvehv++++r++h+l+r
  Do002375.1 399 gsynGALQVMSMEFQVPSPLVPtRECYFARYCKNNPDGTWVVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRSVHNLYR 493
                 ****************************************************98....7**************************************** PP

                 HHHHHHHHHHHHHHHHHTXXXXXX CS
       START 183 slvksglaegaktwvatlqrqcek 206
                 +lv+sgla+gak+wv tl+rqce+
  Do002375.1 494 PLVNSGLAFGAKRWVGTLDRQCER 517
                 **********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2379155IPR009057Homeodomain-like
SuperFamilySSF466897.1E-2084157IPR009057Homeodomain-like
PROSITE profilePS5007117.02297157IPR001356Homeobox domain
SMARTSM003891.1E-1998161IPR001356Homeobox domain
PfamPF000464.2E-18100155IPR001356Homeobox domain
CDDcd000861.47E-19100158No hitNo description
PROSITE patternPS000270132155IPR017970Homeobox, conserved site
PROSITE profilePS5084837.394290520IPR002913START domain
SuperFamilySSF559611.1E-31291519No hitNo description
CDDcd088751.60E-115294516No hitNo description
SMARTSM002343.4E-52299517IPR002913START domain
PfamPF018527.7E-49300517IPR002913START domain
Gene3DG3DSA:3.30.530.201.9E-6391516IPR023393START-like domain
SuperFamilySSF559612.58E-24539772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MTPARRMPAM IGRTGVAYGS SSALSLSQAD LLDSHHLQQA FQQQLFDQIP GGAVDSGDNI  60
IHGRSDTLAD EFESKSCSEN PDGTSGDDGQ EDPNQRPNKK KRYHRHTQHQ IQEMEAFFKE  120
CPHPDDKQRK ELSRELGLEP LQVKFWFQNK RTQMKNQHER QENSQLRAEN DKLRAENMRY  180
KEALTTASCP SCGGPAALGE MSFDEHHLRL ENARLRDEID RISGIAAKHV GKPMVSFPVL  240
SSPLAAAAAR SPLDVVGAFG VQPASLGADH LFGVGAGAGE LLRSMSTGQL DADKPMIVKL  300
AVAAMDELLG MARVDAPLWG SGTAGAQLDE EEYGRMFPGG LGPRQFGLRP EASRDGAVVI  360
MTRDSLVEIL MDANRFAAVF SSIVSRASTH EVLSTGVAGS YNGALQVMSM EFQVPSPLVP  420
TRECYFARYC KNNPDGTWVV VDVSLDSLRP SPVLKCRRRP SGCLIQEMPN GYSKVTWVEH  480
VEVDDRSVHN LYRPLVNSGL AFGAKRWVGT LDRQCERLAS AMASNIPNGD LGVITSIEGR  540
KSMLKLAERM VASFCGGVTA SAAHQWTTLS GSGAEDVRVM TRKSVDDPGR PPGIVLNAAT  600
SFWLPVPPKR VFDFLRDETS RSEWDILSNG GAVQEMAHIA NGRDHGNCVS LLRVNSANSN  660
QSNMLILQES CTDASGSYVV YAPVDVVAMN VVLNGGDPDY VALLPSGFAI LPDGPPGASP  720
HGEISASLEA GGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIACTVDR IKAAVCAEGN  780
PQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo002375.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509870.0AJ250987.1 Zea mays mRNA for OCL5 protein (ocl5 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972697.10.0homeobox-leucine zipper protein ROC1
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLA0A1E5V0C90.0A0A1E5V0C9_9POAL; Homeobox-leucine zipper protein ROC1
STRINGSi013285m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Lee JH, et al.
    Characterization of Arabidopsis and rice DWD proteins and their roles as substrate receptors for CUL4-RING E3 ubiquitin ligases.
    Plant Cell, 2008. 20(1): p. 152-67
    [PMID:18223036]
  2. Yi J, et al.
    OsMPK6 plays a critical role in cell differentiation during early embryogenesis in Oryza sativa.
    J. Exp. Bot., 2016. 67(8): p. 2425-37
    [PMID:26912801]
  3. Dou M,Cheng S,Zhao B,Xuan Y,Shao M
    The Indeterminate Domain Protein ROC1 Regulates Chilling Tolerance via Activation of DREB1B/CBF1 in Rice.
    Int J Mol Sci, 2016. 17(3): p. 233
    [PMID:26927068]
  4. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]