PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 308aa    MW: 33731.8 Da    PI: 9.0291
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002362.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.1e-52191511129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhP+dee++++yL +kv ++ +++  +i e+d++k+ePw+Lp k+k +ekewyfF ++d+ky+tg r+nrat++gyWkatgkdke+++++ ++
  Do002362.1  19 LPPGFRFHPRDEEIITFYLMPKVLQRGFTC-AAIGEADLNKTEPWELPGKAKMGEKEWYFFYRKDRKYPTGIRANRATEAGYWKATGKDKEIYRATASA 116
                 79**************************99.88***************99999*****************************************84444 PP

         NAM 100 .....vglkktLvfykgrapkgektdWvmheyrle 129
                      +g+kktLvfykgrap+gekt+Wvmhe+rle
  Do002362.1 117 alpmlIGMKKTLVFYKGRAPRGEKTNWVMHEFRLE 151
                 67888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-6013187IPR003441NAC domain
PROSITE profilePS5100556.41619187IPR003441NAC domain
PfamPF023654.1E-2720150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MGDQQQQQQG MSVGDSLELP PGFRFHPRDE EIITFYLMPK VLQRGFTCAA IGEADLNKTE  60
PWELPGKAKM GEKEWYFFYR KDRKYPTGIR ANRATEAGYW KATGKDKEIY RATASAALPM  120
LIGMKKTLVF YKGRAPRGEK TNWVMHEFRL EGSGKLPCPT SSSTSTAAMK SLSISKDEWV  180
VCRVFHKTTR IKKEHVHAPS SYTMAMASGD IDQSTIPMPI SMQFPMLQDF TMDPTASYYS  240
IASGGSSSMP PVMPPMAGMG NAGLPANGAL FGNLMAPALP VSFYPQMGIG ACATGIDGFM  300
ATPESGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-481719315171NO APICAL MERISTEM PROTEIN
1ut4_B3e-481719315171NO APICAL MERISTEM PROTEIN
1ut7_A3e-481719315171NO APICAL MERISTEM PROTEIN
1ut7_B3e-481719315171NO APICAL MERISTEM PROTEIN
3swm_A3e-481719318174NAC domain-containing protein 19
3swm_B3e-481719318174NAC domain-containing protein 19
3swm_C3e-481719318174NAC domain-containing protein 19
3swm_D3e-481719318174NAC domain-containing protein 19
3swp_A3e-481719318174NAC domain-containing protein 19
3swp_B3e-481719318174NAC domain-containing protein 19
3swp_C3e-481719318174NAC domain-containing protein 19
3swp_D3e-481719318174NAC domain-containing protein 19
4dul_A3e-481719315171NAC domain-containing protein 19
4dul_B3e-481719315171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660230.11e-152PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotQ9FLR39e-77NAC79_ARATH; NAC domain-containing protein 79
TrEMBLK3ZUK31e-152K3ZUK3_SETIT; Uncharacterized protein
STRINGSi030284m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.15e-77NAC domain containing protein 80