PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 288aa    MW: 31423.3 Da    PI: 6.0302
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002250.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.61.3e-35121111100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rr+C+++C+la+yfp+++p+ f+n+h+lFG+sn+lk+l+++ +e+r++am++++ye++a+   P +G+v +i+ lqq+++q++ +l ++++
  Do002250.1  12 ACAACKYQRRRCTPECPLAEYFPHDRPRVFRNAHRLFGVSNILKTLARAGPEKRREAMHCIIYESQAWDIYPASGCVPIIHGLQQRIRQAELDLRSVHA 110
                 7******************************************************************************************99999887 PP

      DUF260 100 e 100
                 +
  Do002250.1 111 N 111
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.70511112IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-3412108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAAPGGGGAG AACAACKYQR RRCTPECPLA EYFPHDRPRV FRNAHRLFGV SNILKTLARA  60
GPEKRREAMH CIIYESQAWD IYPASGCVPI IHGLQQRIRQ AELDLRSVHA NIQAYRAAQG  120
RDVPELDGDS FGAASPPAPP TSFQFQPAAG NNDNAGGGGL SFFYGGDLMN AATSNDDNIA  180
TETSIAPLQM PSWIMQTPHY NMKNTAAAAN VVGKLVPQPS HDYRFLVDAT MVQHQPQQPI  240
PMQPAELDDE MSYFVEDGDN EMLHESSMNT SENKAMKAPK MEDANGFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2421241123LOB family transfactor Ramosa2.1
5ly0_B3e-2421241123LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo002250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-45HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025813245.11e-121protein LATERAL ORGAN BOUNDARIES-like
TrEMBLA0A1E5UTR90.0A0A1E5UTR9_9POAL; Uncharacterized protein
STRINGPavir.J35697.1.p1e-115(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154591316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-26LOB domain-containing protein 27