PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002217.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 229aa    MW: 24683.9 Da    PI: 10.456
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002217.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.5e-28100149251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Do002217.1 100 PRMRWTTALHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQ 149
                 9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-2597150IPR009057Homeodomain-like
SuperFamilySSF466896.81E-1498152IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-20100150IPR006447Myb domain, plants
PfamPF002493.3E-6101149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSTTSSRMTT TATPDLSLHI SPPSPAAAGG EMQVEPRLLL GLELDDDTTA AAAAKTDKAA  60
ALRQGGLQVP QQRLHQPSQT AHGFKKSSGG TGGRRNARAP RMRWTTALHA HFVHAVELLG  120
GHERATPKSV LELMNVKDLT LAHVKSHLQA RLLSLLFYQH MYRTVKGTDR SCVAGHGQAR  180
DMVFLRRGAG EVDGFDVFNS NNSVNTTTTF NNNTSSDFAA LGGFIWTPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14101149351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14101149351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14101149351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14101149351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo002217.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9684684e-66EU968468.1 Zea mays clone 321144 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442430.22e-92uncharacterized protein LOC8069722 isoform X1
TrEMBLA0A1E5W9E21e-167A0A1E5W9E2_9POAL; Putative transcription factor KAN4
STRINGSb08g019940.13e-95(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.22e-36G2-like family protein