PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do002102.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 450aa    MW: 49702.1 Da    PI: 4.2638
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do002102.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.73.3e-5161331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtd elv++yLk+k+ gkkl + ++i+evd+yk+ PwdLp k ++++++ ew+fF++rdkky++g+r+nrat +gyWk++gkd++++  ++
  Do002102.1   6 LPPGFRFHPTDVELVSYYLKRKIMGKKLIV-DAISEVDLYKFPPWDLPdKsSLRSKDLEWFFFCPRDKKYPNGSRTNRATPNGYWKTSGKDRTIML-NS 102
                 79*************************988.89**************95335666777**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + vg+kktL+f++g+apkg +tdWvm ey++
  Do002102.1 103 RIVGMKKTLIFHEGKAPKGDRTDWVMYEYKM 133
                 9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-623156IPR003441NAC domain
PROSITE profilePS5100557.9286156IPR003441NAC domain
PfamPF023653.0E-267132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MAQTSLPPGF RFHPTDVELV SYYLKRKIMG KKLIVDAISE VDLYKFPPWD LPDKSSLRSK  60
DLEWFFFCPR DKKYPNGSRT NRATPNGYWK TSGKDRTIML NSRIVGMKKT LIFHEGKAPK  120
GDRTDWVMYE YKMEDEDLVS AGFSKDAFVL CKIFKKSGLG PRIGEQYGAP FNESEWDIAE  180
AETSMFPLMT SSEVVNPTEV PHTQHAAPAG AAHEPPLHNT SAACAGEESS FDHATASTCI  240
EDLTFGYTVA ASAIQDIPAQ QSGDGVVSGN NISNGANDMY SQDCDGFLLE ELSRFLNDSP  300
LHDLGESSGL PPMSEAEAHA FEVNTFDPYN ELSGLAGLES MSNNFSASNV GTTDYTILPP  360
DRELSTDDYL ELNDLLASDP SFPSEFPAQN NQFMQYAQSS DNGHYDVSML SGPMEPAMPS  420
SCDVFPPNNG SFTTDEATNY LYPTMQYPFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-52215711169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7279770.0KJ727977.1 Zea mays clone pUT6091 NAC transcription factor (NAC38) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660428.10.0PREDICTED: NAC domain-containing protein 82-like
RefseqXP_014660429.10.0PREDICTED: NAC domain-containing protein 82-like
TrEMBLA0A096TWC00.0A0A096TWC0_MAIZE; Uncharacterized protein
STRINGSb09g020880.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47313664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-83NAC domain containing protein 103