PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001819.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family WOX
Protein Properties Length: 168aa    MW: 19125.7 Da    PI: 9.746
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001819.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-202988357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R++++++q+++Le l++   r+p+  ++e+++++l    +++ ++V++WFqN++a+e++
  Do001819.1 29 TRWNPSPDQIKVLEMLYRGgMRTPNSFQIEQITEELgkygRIEGKNVFYWFQNHKARERQ 88
                8*****************99**************************************97 PP

2Wus_type_Homeobox115.82.1e-372890365
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +tRW+P+p+Qik+Le+ly+ G+rtPn+ +i++it+eL +yG+ie+kNVfyWFQN+kaRerqkq
         Do001819.1 28 TTRWNPSPDQIKVLEMLYRGGMRTPNSFQIEQITEELGKYGRIEGKNVFYWFQNHKARERQKQ 90
                       79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.9282489IPR001356Homeobox domain
SMARTSM003892.8E-72693IPR001356Homeobox domain
SuperFamilySSF466894.71E-132794IPR009057Homeodomain-like
CDDcd000862.12E-52990No hitNo description
Gene3DG3DSA:1.10.10.602.6E-82988IPR009057Homeodomain-like
PfamPF000466.1E-182988IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MVVLPEFARV RNASRLLNCT VQVPTAGTTR WNPSPDQIKV LEMLYRGGMR TPNSFQIEQI  60
TEELGKYGRI EGKNVFYWFQ NHKARERQKQ KRAALLTLST TSSLPPAETK DGVEKKKEAY  120
EDASRRKRRC RTWGDVHGDG ATTEVVAECT DDVTLELFPL RPDQGKAN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114128KKKEAYEDASRRKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo001819.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0355181e-93BT035518.1 Zea mays full-length cDNA clone ZM_BFb0067L08 mRNA, complete cds.
GenBankBT0851951e-93BT085195.1 Zea mays full-length cDNA clone ZM_BFb0326G17 mRNA, complete cds.
GenBankEU9642751e-93EU964275.1 Zea mays clone 277479 WUSCHEL-related homeobox 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977039.11e-95WUSCHEL-related homeobox 4
SwissprotQ25AM22e-78WOX4_ORYSI; WUSCHEL-related homeobox 4
SwissprotQ7XTV32e-78WOX4_ORYSJ; WUSCHEL-related homeobox 4
TrEMBLA0A1E5VX721e-123A0A1E5VX72_9POAL; WUSCHEL-related homeobox 4
STRINGSi012229m6e-95(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP126923035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-38WUSCHEL related homeobox 4