PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do001594.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 501aa    MW: 55894.4 Da    PI: 6.634
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do001594.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.51.2e-1271305001373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++c +av++ ++   +al+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e    +sse +++++l+++++P++kf+++ aN
  Do001594.1 130 LRQLLIACGKAVDE-NACYMDALMSELRKMVSVSGEPMQRLGAYMLEGLIARLSSTGHALYKSLKCKEPV-ATSSELMSYMHLLYDICPFFKFGYMSAN 226
                 689*********98.88999************************************************97.789999********************** PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  aI +av+ge+ +HiiDf+i qG QW++++qaLasRp+  p lRiTg+++++s   +  el  +g+rL+++A+++g+pfefn+ v  + +++ +e+L +
  Do001594.1 227 GAIADAVKGENFIHIIDFQIAQGSQWMTMIQALASRPGRRPYLRITGIDDSNSAhaRGGELDIVGQRLQSIAHKCGLPFEFNA-VPAASHEVMYEHLCI 324
                 **************************************************888888999************************.79999999******* PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 +pgEa++Vn+++qlh+++desv +e++rd++L++vkslsP+vv++veqea++n+++F+ r le+l+yy+a+f+++++  pr++++ri+ E+++++r+iv
  Do001594.1 325 RPGEAIVVNFAYQLHHTPDESVGIENHRDRILRMVKSLSPRVVTLVEQEANTNTAPFFLRYLETLDYYTAMFEAIDVARPRDDKKRISAEQHCVARDIV 423
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 n++acegaer+erhe ++kWr+rl +aGF+p+pls  ++ ++k+ll  ++s  yr+ee++g l+lgWk+r+Lv+ SaW
  Do001594.1 424 NLIACEGAERIERHEPFGKWRARLAMAGFRPYPLSLVVNRTIKTLLDSYHSC-YRLEERDGVLYLGWKNRKLVVSSAW 500
                 **************************************************55.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.277104482IPR005202Transcription factor GRAS
PfamPF035144.0E-125130500IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MPQNHDDVHY ISSDDGSQTI NSRPQGFQAQ YSTLDSSSVN CVYPAHSSTS SQSRSGSPLS  60
QQASHSDHAY GSSPSVSCVT QVPSWTLQEL ENVMFGPDSD IGSPDSSMLP GTALHEINWR  120
ELLGIKSGDL RQLLIACGKA VDENACYMDA LMSELRKMVS VSGEPMQRLG AYMLEGLIAR  180
LSSTGHALYK SLKCKEPVAT SSELMSYMHL LYDICPFFKF GYMSANGAIA DAVKGENFIH  240
IIDFQIAQGS QWMTMIQALA SRPGRRPYLR ITGIDDSNSA HARGGELDIV GQRLQSIAHK  300
CGLPFEFNAV PAASHEVMYE HLCIRPGEAI VVNFAYQLHH TPDESVGIEN HRDRILRMVK  360
SLSPRVVTLV EQEANTNTAP FFLRYLETLD YYTAMFEAID VARPRDDKKR ISAEQHCVAR  420
DIVNLIACEG AERIERHEPF GKWRARLAMA GFRPYPLSLV VNRTIKTLLD SYHSCYRLEE  480
RDGVLYLGWK NRKLVVSSAW C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-601275001374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672840.0BT067284.1 Zea mays full-length cDNA clone ZM_BFb0379I09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985375.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8830.0K4A883_SETIT; Uncharacterized protein
STRINGSi035089m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein