PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family LBD
Protein Properties Length: 215aa    MW: 22405.4 Da    PI: 9.5115
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000955.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301.1e-40311301100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf   +p+kfa+vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l+aela++++
  Do000955.1  31 PCAACKLLRRRCAQECPFSPYFSPLEPHKFAAVHKVFGASNVSKMLLEVHESQRADATNSLVYEANLRLRDPVYGCMGAILTLQQQVQALEAELATVRA 129
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Do000955.1 130 E 130
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.36930131IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4031128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MTAARRSCSL PAGAGAVAGA GPGSALNTIT PCAACKLLRR RCAQECPFSP YFSPLEPHKF  60
AAVHKVFGAS NVSKMLLEVH ESQRADATNS LVYEANLRLR DPVYGCMGAI LTLQQQVQAL  120
EAELATVRAE IVRHRYRPTA AATSPVATVL PSSHASQLLA ASAASRGLHA RRPVGTRTAT  180
LAAASSSSSS AVYAAAASSS TDYSSITNEN VPYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-403113411114LOB family transfactor Ramosa2.1
5ly0_B9e-403113411114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000955.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0958311e-133FP095831.1 Phyllostachys edulis cDNA clone: bphyst036h20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808905.11e-109LOB domain-containing protein 15-like isoform X2
SwissprotQ9AT616e-69LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A1E5W3W51e-152A0A1E5W3W5_9POAL; LOB domain-containing protein 13
STRINGPavir.Ca01098.1.p1e-109(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.18e-59LOB domain-containing protein 13
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]