PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRAS
Protein Properties Length: 547aa    MW: 60238.1 Da    PI: 6.4749
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000821.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS437.11.3e-1331785462373
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                  elL++cA+av++++  +++ ++ +l++++s +g+p++Rl ay++e+L arla+s++++ykal+++e +   ss+ l+++++++e++P++kf+++ aN 
  Do000821.1 178 NELLIACARAVEQNNSFAIDLMIPELRKMVSVSGEPLERLGAYMVEGLVARLASSGNSIYKALKCKEPK---SSDLLSYMHFLYEACPYFKFGYMSANG 273
                 689*****************************************************************9...9************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                 aI eav+ge+r+HiiDf i qG+QW++LlqaLa+Rp+gpp +RiTg++++ s   +   le +g+rL+++A   +vpf+fn+ va + +++e  +L + 
  Do000821.1 274 AIAEAVKGEDRIHIIDFHIAQGAQWISLLQALAARPGGPPFVRITGIDDSFSAysRGGGLELVGRRLSHIAGLYKVPFQFNA-VAVSGSEVEEGHLGIV 371
                 *************************************************777688999************************.7999************ PP

        GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                 pgEa+aVn+ l+lh+++de+vs+ ++rd++L+lvk+lsPkv+++veqe+++n+++F++rf+e+l+yy+a+f+s++  lpr+++eri++E+++l+reivn
  Do000821.1 372 PGEAIAVNFTLELHHIPDETVSTVNHRDRILRLVKGLSPKVLTLVEQESNTNTAPFAQRFAETLDYYTAIFESIDLALPRDDRERINMEQHCLAREIVN 470
                 *************************************************************************************************** PP

        GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 +vaceg+er+erhe ++kW++rl++aGF+p pls  +++++k+ll+ ++ d y++ e++g l+lgWk+rpLv+ SaW
  Do000821.1 471 LVACEGEERVERHEVFGKWKARLMMAGFRPSPLSALVNATIKTLLQSYSPD-YKLAERDGVLYLGWKNRPLVVSSAW 546
                 *************************************************66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.438151528IPR005202Transcription factor GRAS
PfamPF035144.4E-131178546IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MADTPTSRMV HPFGNVPRQT PKQFMYSGNS QHLCHPYQSA SDTHIVPQHH YTMKSHSPDA  60
GSDDHETHKQ YTLDSSAASG CSRHDSPSSQ SIHTGSGSPL SHEDSHSGST NGNGSPVSAS  120
CVTEDPTDLK QKLKDLEAVM LGTDSEIVNS LQTSVANQLS LEPEKWVHMM SMPKGNLNEL  180
LIACARAVEQ NNSFAIDLMI PELRKMVSVS GEPLERLGAY MVEGLVARLA SSGNSIYKAL  240
KCKEPKSSDL LSYMHFLYEA CPYFKFGYMS ANGAIAEAVK GEDRIHIIDF HIAQGAQWIS  300
LLQALAARPG GPPFVRITGI DDSFSAYSRG GGLELVGRRL SHIAGLYKVP FQFNAVAVSG  360
SEVEEGHLGI VPGEAIAVNF TLELHHIPDE TVSTVNHRDR ILRLVKGLSP KVLTLVEQES  420
NTNTAPFAQR FAETLDYYTA IFESIDLALP RDDRERINME QHCLAREIVN LVACEGEERV  480
ERHEVFGKWK ARLMMAGFRP SPLSALVNAT IKTLLQSYSP DYKLAERDGV LYLGWKNRPL  540
VVSSAWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-661815478375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639280.0BT063928.1 Zea mays full-length cDNA clone ZM_BFc0120M18 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958142.10.0PREDICTED: chitin-inducible gibberellin-responsive protein 2
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK3ZS380.0K3ZS38_SETIT; Uncharacterized protein
STRINGSi029418m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein