PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 320aa    MW: 34991.1 Da    PI: 6.0611
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000758.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18155209256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++keq   Le+ F++++++s +++ +LAk+l+L  rqV vWFqNrRa+ k
  Do000758.1 155 RKKLRLSKEQSAFLEDSFKEHNTLSPKQKSDLAKRLNLRPRQVEVWFQNRRARTK 209
                 788899***********************************************98 PP

2HD-ZIP_I/II1253.4e-40155243189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr +++l++en+rL++ev+eLr+
   Do000758.1 155 RKKLRLSKEQSAFLEDSFKEHNTLSPKQKSDLAKRLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRFCENLAQENRRLHREVAELRA 243
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-18137209IPR009057Homeodomain-like
PROSITE profilePS5007117.232151211IPR001356Homeobox domain
SuperFamilySSF466892.41E-18152220IPR009057Homeodomain-like
SMARTSM003897.3E-17153215IPR001356Homeobox domain
PfamPF000467.1E-16155209IPR001356Homeobox domain
CDDcd000863.10E-17155212No hitNo description
PROSITE patternPS000270186209IPR017970Homeobox, conserved site
SMARTSM003404.6E-21211254IPR003106Leucine zipper, homeobox-associated
PfamPF021833.9E-10211244IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MELELSLGDS PAPAKGNLTP VLTPTHAGKG EDHELVLELG VGTSKRIEQD NQKTSTQPED  60
VQDQEEDDEA CFRSKSPVEL SLGCPLLPAS AEIGSVNSEE CGRGFHVNTV LVDGDAVQGR  120
SLSTSSLPME VPVRQAADEE AAEDEENSGV GGGARKKLRL SKEQSAFLED SFKEHNTLSP  180
KQKSDLAKRL NLRPRQVEVW FQNRRARTKL KQTEVDCEYL KRFCENLAQE NRRLHREVAE  240
LRALGTTPYP FYGHLPAAGF SSTARVCSSC DNKVAAHYPA ITSTSPVVAP PSPVPTLFAR  300
PHFGPFTVHP VLRRQPSATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203211RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000758.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.10.0homeobox-leucine zipper protein HOX7
SwissprotA2X6741e-108HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLA0A1E5VT780.0A0A1E5VT78_9POAL; Homeobox-leucine zipper protein HOX7
STRINGSi019736m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-54homeobox from Arabidopsis thaliana