PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000713.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 456aa    MW: 50834 Da    PI: 5.8356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000713.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.29e-34257311155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprlrWt eLHerFveav++LGG+ekAtPk +l+lmkv+gLt++hvkSHLQkYR 
  Do000713.1 257 KPRLRWTLELHERFVEAVNKLGGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRF 311
                 79****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.623254314IPR017930Myb domain
SuperFamilySSF466892.33E-17255311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-31256312IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-25257311IPR006447Myb domain, plants
PfamPF002491.3E-9259310IPR001005SANT/Myb domain
PfamPF143796.8E-21341387IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MSDYLIGLGT ACSYSDIHYV VLDQAVVNDQ RHRKPRRAMS TQSIKSEMIG SMSLTKILPF  60
DLQKCSPDSN PESAVSRISQ AALSVPISSS SSTFCTSMFS PFQTNSESCR QKGALPFLPH  120
PPKCEQQQQQ ISAGQSSSTS SLLFGADLSN VGHDDAERSG DLKDFLNLSG DVSEGSFHGE  180
SNAMAFSEQM EFQFLSEQLG IAITNNEESP RLDDIYDRPP QTSSCPVPSY SDQEDLPSTV  240
SPVKVQLSSS RAAACNKPRL RWTLELHERF VEAVNKLGGP EKATPKGVLK LMKVEGLTIY  300
HVKSHLQKYR FATYLPEIKE EDKKSQTVIP GSDAGKKKSL QVAEALRMQM EVQKQLHEQL  360
EVQRQLQLHI EEHARYLQKI LEEQQKARNS LSAKRNSTQD PLPESTEKEE TEMKAETTSD  420
PLSRQKISDT DMECNSQVDN KNAKAQVDLE KETLRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-26257314259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR1 and PHR2 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:26082401}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000713.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated under Pi starvation conditions. {ECO:0000269|PubMed:26082401}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0383171e-123BT038317.1 Zea mays full-length cDNA clone ZM_BFb0227D23 mRNA, complete cds.
GenBankEU9545901e-123EU954590.1 Zea mays clone 1472551 hypothetical protein mRNA, complete cds.
GenBankJX4699781e-123JX469978.1 Zea mays subsp. mays clone UT3338 G2-like transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698680.10.0protein PHOSPHATE STARVATION RESPONSE 3
SwissprotQ6YXZ40.0PHR3_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 3
TrEMBLA0A1E5VWC10.0A0A1E5VWC1_9POAL; Protein PHOSPHATE STARVATION RESPONSE 3
STRINGPavir.Aa03223.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-79G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]