PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000506.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family HD-ZIP
Protein Properties Length: 1913aa    MW: 211324 Da    PI: 6.9987
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000506.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-2112551310156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox    1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56  
                  +++ +++t++q++eLe+lF+++++p++++r eL+++lgL+ rqVk+WFqNrR+++k
  Do000506.1 1255 KKRYHRHTPQQIQELEALFKECPHPDEKQRGELSRRLGLDPRQVKFWFQNRRTQMK 1310
                  678899***********************************************998 PP

2START74.13.6e-241450154794206
                  EEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHH CS
       START   94 mvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksgl 189 
                  m+aelq+lsplvp R+++f+R+++ql +g w++vdvSvd     ++                  ++ +  +vtwveh++++++++h l+r+l++sgl
  Do000506.1 1450 MKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSVDGLVRDQN----------------SATASNAGNVTWVEHTEYDEASVHHLYRPLLRSGL 1530
                  89************************************97655553................122233348************************** PP

                  HHHHHHHHHHTXXXXXX CS
       START  190 aegaktwvatlqrqcek 206 
                  a+ga++w+a lqrqce+
  Do000506.1 1531 AFGARRWLAMLQRQCEC 1547
                  ***************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2002.1E-5467IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF561122.6E-4535212IPR011009Protein kinase-like domain
PROSITE profilePS5001124.49954382IPR000719Protein kinase domain
SMARTSM002204.7E-1254300IPR000719Protein kinase domain
PfamPF000696.8E-3056206IPR000719Protein kinase domain
PROSITE patternPS0010706082IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:3.30.200.202.0E-2368116No hitNo description
Gene3DG3DSA:1.10.510.103.0E-20117205No hitNo description
PROSITE patternPS001080176188IPR008271Serine/threonine-protein kinase, active site
SuperFamilySSF527998.12E-5288401IPR029021Protein-tyrosine phosphatase-like
SMARTSM013268.5E-42412551IPR014020Tensin phosphatase, C2 domain
PfamPF104093.6E-28414550IPR014020Tensin phosphatase, C2 domain
PROSITE profilePS5118227.802414552IPR014020Tensin phosphatase, C2 domain
Gene3DG3DSA:2.60.40.11101.7E-15414551No hitNo description
SuperFamilySSF495623.6E-21416551IPR000008C2 domain
SMARTSM004981.6E-56931163IPR015425Formin, FH2 domain
PfamPF021817.4E-9893939IPR015425Formin, FH2 domain
SuperFamilySSF1014471.28E-558931122No hitNo description
PfamPF021816.9E-479381122IPR015425Formin, FH2 domain
SuperFamilySSF466895.85E-2112371310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-2312401310IPR009057Homeodomain-like
PROSITE profilePS5007118.04212521312IPR001356Homeobox domain
SMARTSM003891.8E-2012531316IPR001356Homeobox domain
CDDcd000868.48E-1912541310No hitNo description
PfamPF000463.8E-1912551310IPR001356Homeobox domain
PROSITE patternPS00027012871310IPR017970Homeobox, conserved site
SuperFamilySSF559611.17E-814481547No hitNo description
PfamPF018522.7E-1914501547IPR002913START domain
PROSITE profilePS5084811.02914901550IPR002913START domain
SuperFamilySSF559613.66E-2115671775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006468Biological Processprotein phosphorylation
GO:0009556Biological Processmicrosporogenesis
GO:0051017Biological Processactin filament bundle assembly
GO:0005819Cellular Componentspindle
GO:0009524Cellular Componentphragmoplast
GO:0009574Cellular Componentpreprophase band
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0008017Molecular Functionmicrotubule binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0051015Molecular Functionactin filament binding
Sequence ? help Back to Top
Protein Sequence    Length: 1913 aa     Download sequence    Send to blast
LVTTFVVMVA TALYLSLKRR YNEAIHLKVE MFLKTYGMSK PTRYTFSEVK KIARRFKEKV  60
GQGGFGTVYK GHLPNGVPVA VKMLENSTEE GEEFINEVAT IGQIHHANIV RLLGFCSEGT  120
RRVLIYEFMP NESLERYVFL HDSNSQELLV PEKMLDIATG IARGTEDLHQ GCNQRILHFD  180
IKPHNILLDY SFNPKISDFG LAKLFITTFL HSHEMSLLSR FFYKRPPDGL LEFIERIYVF  240
DSCFSTEVLP QGMYPVYLNE ILTELHEEHI ESSFLAINFR DGDKRSQLAD ILREYNIPVI  300
DYPRHFEGCP VLPLSLIQHF LRVCEHWLSG GNNKNIILLH CERGTWPLLA FLLSCLLIYK  360
KLHGAEHKTL DIIYREAPKG FLQLFSALNP MPSQLRYMQY VARRNISPEW PPMERALSLD  420
CLILRAIPSF DSDNGCRPLV RIFGRNLLGK NGSMTNMIFS MPKKKSLRHY RQEDCDVIKI  480
DIQCLVQGDI VLECVHLDLD PEKEVMMFRI MFNTAFIRSN VLMLNSDDVD ILWGSKERYP  540
KNFRAEVLFC EIGGMSPTRA PTATLNGDMK GGLPIEAFSA VQELFNGVDW IESSDDAAYW  600
LLKEFSANSL QEKFQKLILN DMKELSKMQA KVGLQMPLMS PLDSDEEKYS VASDSVCSAE  660
HEKVQHGGNS SDSENIDRDL TTEDSESSAT LSINSSSPPQ QPQPPLPPHG LPSSLSASSV  720
LATGPTGPLT KPLQELPSNR LPFSPPAPPP LPPQSGRKPA SSQPPPPPPP SGSKHVFSSP  780
PPPPPPPPPP RISSAGPPQP PPPPPPLNGS KHILSPPPPP PRISSVAPLQ PPPPPPPPPP  840
PLPNSGAAKQ QNVCAAPPPP PPPPAHGITN KGXXXXXXXX XKDHLLHLHL HLSAILALDT  900
SVLDNDQVEN LIKFCPTKEE IEMLKGYNGN KEMLGKCEQV DDLRTNLTTI NDATKEVKES  960
LKLRQIMQTI LTLGNALNQG TARGSAVGFR LDSLLKLSDT RARNNKMTLM HYLCKVFTFR  1020
GSGGQGLLVC FKDFRKPMIQ LKLLAEEMQA INKGLEKVEQ ELAASENDGA ISIGFRKALK  1080
SFLDAAEAEV RSLISLYAEV GRNADSLAQY FGEDPARCPF EQGCLCECQD FGALCSPPDS  1140
VRGSGPSLFG RRERHGGGMS FGSLFDGGAG GGGGGMQFPF SAGFSSSPAL SLGLDNNAGM  1200
GGGRVLPGGA GTGGGMARDA DAENDSRSGS DHLDAMSGGG EDEDDAEPGN PRKRKKRYHR  1260
HTPQQIQELE ALFKECPHPD EKQRGELSRR LGLDPRQVKF WFQNRRTQMK VSRLLPISFF  1320
IYCPDFRPLF RFLTWFLVPV ISLAKTQLER HENALLKQEN DKLRAENMTI REAMRSPMCG  1380
SCGSPAMLGE VSLEEQHLCI ENARLKDELN RVYALATKFL GKPMSMLAGP MMQPHLSSLP  1440
MPSSSLELAM KAELQVLSPL VPIREVTFLR FCKQLAEGAW AVVDVSVDGL VRDQNSATAS  1500
NAGNVTWVEH TEYDEASVHH LYRPLLRSGL AFGARRWLAM LQRQCECLAI LMSPDTVSAN  1560
DSSVITQEGK RSMLKLARRM TENFCAGVSA SSAREWSKLD GATGSIGEDV RVMARKSVDE  1620
PGEPPGVVLS AATSVWVPVA PEKLFNFLRD EQLRAEWDIL SNGGPMQEMA NIAKGQEHGN  1680
SVSLLRASAM SANQSSMLIL QETCTDASGS MVVYAPVDIP AMQLVMNGGD STYVALLPSG  1740
FAILPDGPGT GNGHKTGGSL LTVAFQILVN SQPTAKLTVE SVETVNNLIS CTIKKIKTAL  1800
QCDATANFST ASIVILAFQY LWARCDYKNV QSGSTSDKLH IPQGKCYSRF EMKHPMPDNQ  1860
MNHKNIQNAI LIGWFSSEFA ARPKLDTEKV HVSKLLQCAD LKFSGFFFQQ HHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j5t_A9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5t_D9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5t_I9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5t_J9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5t_M9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5u_C9e-294420374242Probable serine/threonine-protein kinase PBL2
6j5v_C9e-294420374242Probable serine/threonine-protein kinase PBL2
6j6i_A9e-294420374242Probable serine/threonine-protein kinase PBL2
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
112501256PRKRKKR
212511255RKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000506.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0632490.0BT063249.1 Zea mays full-length cDNA clone ZM_BFc0042P14 mRNA, complete cds.
GenBankBT0644530.0BT064453.1 Zea mays full-length cDNA clone ZM_BFc0170E20 mRNA, complete cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-154homeodomain GLABROUS 1