PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000493.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family GRF
Protein Properties Length: 385aa    MW: 42156.8 Da    PI: 8.3596
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000493.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-2590133144
         WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                 d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Do000493.1  90 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE 133
                 79***************************************998 PP

2QLQ58.12.7e-201953236
         QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  Do000493.1 19 PFTASQWQELEHQALIYKCLASGKPIPSYLMPPLR 53
                9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.1E-111854IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-141951IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8141954IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.57390134IPR014977WRC domain
PfamPF088792.1E-2091133IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MMMMSGRAGG GAGAADRYPF TASQWQELEH QALIYKCLAS GKPIPSYLMP PLRRILDSAL  60
ATSPSLAFPP QPSLGWGCFG MGFSRKPDED PEPGRCRRTD GKKWRCSKEA YPDSKYCEKH  120
MHRGKNRSRK PVEMSLATPA PSSNATSATS ATAATATTTT SSPAPTYHRP APAAHDASPY  180
HALYGGSPYA ASARPAGAYH AAQVSPFHLH LDTTHPHPPP SYYSVDQRDY AYGHAAKEVG  240
EHAFFSDGTT ERDRQATGQW QFKNLGVEPK QQSATSLFSV GGYGNGAASA YAVDLTKDDD  300
EEERRRQQQQ QQQHCFVLGA DLRLERPSGH DAAPAQKPLR PFFDEWPHEK GNKGGSWMGF  360
DGETQLSMSI PMATNDFPIT SRHRN
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000269|PubMed:15295073}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000493.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By gibberellic acid (GA3) and submergence. {ECO:0000269|PubMed:10712532, ECO:0000269|PubMed:15295073}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954097.10.0growth-regulating factor 1 isoform X1
SwissprotA2XA731e-169GRF1_ORYSI; Growth-regulating factor 1
TrEMBLA0A1E5W4K90.0A0A1E5W4K9_9POAL; Growth-regulating factor 1 (Fragment)
STRINGPavir.J03212.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-49growth-regulating factor 5