PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do000088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family G2-like
Protein Properties Length: 308aa    MW: 34742.5 Da    PI: 9.0736
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do000088.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.71.3e-332074155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWtp+LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Do000088.1 20 KPRLRWTPDLHQRFVDAVDKLGGPDKATPKSVLRLMGMKGLTLYHLKSHLQKYRL 74
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-321775IPR009057Homeodomain-like
PROSITE profilePS5129413.4081777IPR017930Myb domain
TIGRFAMsTIGR015576.7E-252075IPR006447Myb domain, plants
SuperFamilySSF466891.79E-162075IPR009057Homeodomain-like
PfamPF002491.3E-92273IPR001005SANT/Myb domain
PfamPF143797.6E-7118145IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143791.5E-9169193IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MMEGSYGFGG GGGSMSRDPK PRLRWTPDLH QRFVDAVDKL GGPDKATPKS VLRLMGMKGL  60
TLYHLKSHLQ KYRLGRQGKK STRLELANGG GFATQSLSFP TPAPIPGVPA EGKNTGEMPL  120
ADALRYQIQV QRKLQEQLEV RQVLHHCHEL MHSQTFFHNT TSAYVCNQVQ KKLQMRIEAQ  180
GKYLKAMLEK AQRNISFDAN APSDNIESTR SQLMDFNLSL SGFMDNATRV CEENNEQLVK  240
AISDDNHKDN NLGFQLYQVE SQEAKEVKWT PKTEDSLQLD LNIKGRYDLS SRGMQACELD  300
LKMNQQII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-212076157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo000088.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976682.11e-176myb family transcription factor PHL11
TrEMBLA0A1E5W6B00.0A0A1E5W6B0_9POAL; Myb family transcription factor PHL11
STRINGSi010794m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.15e-59G2-like family protein