PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV56993.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family TALE
Protein Properties Length: 279aa    MW: 31391.5 Da    PI: 8.7612
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV56993.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.14.1e-101311681954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps++++  L++++gL+++qV++WF N R +
  KZV56993.1 131 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 168
                 664559******************************98 PP

2BELL73.63.3e-248611871
        BELL 18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71
                +Vd +Y  y eq+q+++ sF+ ++g g+a  Yt lA+ka+SrhFrc+kdai++ 
  KZV56993.1  8 QVDAKYTEYFEQMQAIVKSFDNIIGQGAAYAYTGLAQKAMSRHFRCIKDAIVGE 61
                79*************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075266.0E-20859IPR006563POX domain
PROSITE profilePS5007112.374109172IPR001356Homeobox domain
CDDcd000861.67E-12112173No hitNo description
SMARTSM003894.4E-9112176IPR001356Homeobox domain
SuperFamilySSF466891.33E-17113179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-29115178IPR009057Homeodomain-like
PfamPF059202.3E-18129168IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MLHYNICQVD AKYTEYFEQM QAIVKSFDNI IGQGAAYAYT GLAQKAMSRH FRCIKDAIVG  60
ELRLSCEALG EKDVAGGSGL TKGETPRLKI LEQKYRQQKA IEHMGMLDPE SWRPQRGLPE  120
RSVNILRSWL FEHFLHPYPS EADKHLLSRQ TGLSKNQVSN WFINARVRLW KPMVEEMYNK  180
EFQEEAQHTA QTPISSISGG QRLEVNAAEK DPSRSTINHG HGTSNSSSSD EGMAAIRGGG  240
GDVVRVLNPA RDVSLTLGLR HGENVPRMSQ LSTRDFRAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-17118175158Homeobox protein Meis1
4xrs_B2e-17118175158Homeobox protein Meis1
5bng_A2e-17118176159Homeobox protein Meis2
5bng_B2e-17118176159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074481.11e-117PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL54e-97BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLE0CPY41e-110E0CPY4_VITVI; Putative uncharacterized protein
TrEMBLK4BV621e-107K4BV62_SOLLC; Uncharacterized protein
STRINGVIT_18s0001g11800.t011e-109(Vitis vinifera)
STRINGSolyc04g079830.2.11e-106(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.35e-98BEL1-like homeodomain 4