PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV56303.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family FAR1
Protein Properties Length: 553aa    MW: 64517.9 Da    PI: 7.9941
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV56303.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.29.9e-2711100191
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 +fYn+YA ++GFsvrk++ ++sk +g + +r+++C +eg+r+++k+   k +r+r+etr+gC a+l+++++ dg ++ t++e++HnHel+p
  KZV56303.1  11 EFYNSYAGRMGFSVRKDYVNRSKIDGAVASRRYTCFREGYRQKDKRG-FKVKRPRKETRVGCMAQLVISRQADGSYRATHFEEQHNHELVP 100
                 6*******************************************999.999**************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-2411100IPR004330FAR1 DNA binding domain
PfamPF105514.4E-26219313IPR018289MULE transposase domain
PROSITE profilePS509669.94502534IPR007527Zinc finger, SWIM-type
SMARTSM005759.9E-6509536IPR006564Zinc finger, PMZ-type
PfamPF044340.001511533IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MGFDSEDHAY EFYNSYAGRM GFSVRKDYVN RSKIDGAVAS RRYTCFREGY RQKDKRGFKV  60
KRPRKETRVG CMAQLVISRQ ADGSYRATHF EEQHNHELVP ACKVRLLRSQ KRSSQTLDCC  120
ASECSAVQPK SLTDLLLTGL RAPGIYNCVS LDHEMILTSK HAWTVKREEA ESIRRYFQTK  180
KLKEPSFSFS IQLDVEEQMI NFFWADEKMM VDYGDFGDVV CFDTTYCLNK DQRPLVLFLG  240
INNHRQVLVF GAAFLYDDTV QSFKWLFRTF IESMSGKKPK TLLTDQGSVI SEAIVSELPD  300
IHHRLCTWQM YQNTLKQLSE VVANLDSLAR DLCGCFFNPD KEDFISSWKS LLDTYGLWEN  360
EWLHTKFELH EKWALSYSKH VFSADIETVL LSEDSVTSLR KYLKPESHIL QYVKHFGRVV  420
NDWRYKELEA NYDMGQQVPK LMGNIIMLKQ VRDLYTPIIF EMFHREYENF LNLVINQFVD  480
SVSSVKYTVC SYGQVRGYEV LYTMEFDSVV CSCMKFQSVG ILCSHALKVL DCRNVKIVPS  540
QYVLKRWTRD ARA
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV56303.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098802.10.0protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011098803.10.0protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_011098804.10.0protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G9GNZ50.0A0A2G9GNZ5_9LAMI; Uncharacterized protein
STRINGMigut.H00048.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-96FAR1-related sequence 5