PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV53836.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Trihelix
Protein Properties Length: 303aa    MW: 34269.8 Da    PI: 8.3543
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV53836.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.94.8e-27158242186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 rW+k +v aLi ++++++++++++  k++lWe+ s  m++ g+ rs+k+Ckekwen+nk+yk +k g+kkr ++ss+tc+yf+ l+
  KZV53836.1 158 RWPKAQVEALIMLKTDLDSKYQDNGTKGTLWEDMSTCMKQLGYDRSAKRCKEKWENINKYYKILKSGKKKR-PGSSKTCAYFNMLD 242
                 8********************************************************************98.9**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.62151215IPR017877Myb-like domain
PfamPF138379.7E-20157243No hitNo description
CDDcd122037.62E-24157222No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MPCSTEFVSV STSTASSSGK QDSERSFQKK RKLADSVLNL MRELLERQED LQRQFVEAIE  60
KCERDREEAW KVQEAARMKR EQEFLAKVRA VSAAKDAAVL AFLRKLSRHM TLPVQVPENL  120
DPMLEQPCER QGGVSKEHAV DLQVNGTGQT STQTNSSRWP KAQVEALIML KTDLDSKYQD  180
NGTKGTLWED MSTCMKQLGY DRSAKRCKEK WENINKYYKI LKSGKKKRPG SSKTCAYFNM  240
LDTLYGERSK DGEHEPDLGG FNMRPEQILM KTIGIQQQSL GEHEQGNGSG DVATSLHPSL  300
PLD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099803.11e-107PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A068UW861e-80A0A068UW86_COFCA; Uncharacterized protein
TrEMBLA0A0V0IK572e-81A0A0V0IK57_SOLCH; Putative trihelix transcription factor GT-2-like
TrEMBLS8CJL01e-80S8CJL0_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc11g005380.1.13e-76(Solanum lycopersicum)
STRINGPGSC0003DMT4000101124e-76(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97942328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-42Trihelix family protein