PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV53784.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Dof
Protein Properties Length: 307aa    MW: 33960.7 Da    PI: 8.6425
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV53784.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-392281362
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                e alkcprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk kk++
  KZV53784.1 22 EPALKCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKGKKMK 81
                6789***************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-262279IPR003851Zinc finger, Dof-type
PfamPF027013.4E-332479IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4692579IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102763IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAPAAGKNEC QGSTSRRNMS QEPALKCPRC DSTNTKFCYY NNYNLTQPRH FCKTCRRYWT  60
KGGALRNVPI GGGCRKGKKM KSSQWVQGDT NGASGISGLK FFQNISPAMD FQLEGLNFLR  120
LHSTNAGLFN NFSPFENISS TCDAVSSSHF LNLNPPASSN SPVLGFSSAS PGFQEMGSLN  180
NIRSNLVPSI ESMSCINQDL HWRLQQQRWN MPFTEDNQKE NSTALHLASN MSTVERPQPI  240
LFQNLDSSKQ DSYGIGTSRK EGDLSTEWFF DNSYAAPAAG RGGHGNNHSW RGIQAWNSDS  300
TQDSVLP
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV53784.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097460.11e-103dof zinc finger protein DOF5.7-like
TrEMBLA0A2Z7CSS41e-114A0A2Z7CSS4_9LAMI; Dof-type zinc finger DNA-binding family protein
STRINGEOX918922e-99(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-57Dof family protein