PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV53223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family VOZ
Protein Properties Length: 448aa    MW: 50571.3 Da    PI: 5.1903
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV53223.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ4051.5e-1242094281217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                 pppsaflgpkcalwdc+rpa  s+w q   dycs++h++la  eg +g  pv+rp+gi+lkd+llfaals+++qgk+vgipecegaatakspwna+elf
  KZV53223.1 209 PPPSAFLGPKCALWDCPRPALASDWSQksdDYCSTYHTQLAPAEGYLGRPPVVRPGGIGLKDNLLFAALSSRAQGKDVGIPECEGAATAKSPWNAPELF 307
                 89*********************99865559******************************************************************** PP

         VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekks 195
                 dl +l+getirewlffdkprrafesg+rkqrslpdy+grgwhesrkq++kef+glkrsyymdpqp+++fewhlyeyeine+da++lyrlelk +d+kks
  KZV53223.1 308 DLIVLDGETIREWLFFDKPRRAFESGSRKQRSLPDYNGRGWHESRKQLVKEFNGLKRSYYMDPQPMENFEWHLYEYEINEYDACTLYRLELKRADGKKS 406
                 *************************************************************************************************** PP

         VOZ 196 akgkvskdsladlqkklgrlta 217
                 +kgk+ +ds+adlqk++grlta
  KZV53223.1 407 PKGKLGNDSVADLQKQMGRLTA 428
                 ********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MGKGSKSGAG KSASHQLLKD RAKNRVDDLQ GMLSNLQSAR KESRTVDVNL LEEQVHQMLR  60
EWKAELNEPS PASSLQQDGS LGSFSSEICR LLQLREEEDD ATSTLAAPKL EPEPDTQKVE  120
TESTSQEGFE VSEGVQEQCL QLVDQSRSSG MVVHHNGMNH MDLTEQLGYH SFDFHPELNE  180
QWFPSCSGTF FMGEDGTPQI HDYQQNITPP PSAFLGPKCA LWDCPRPALA SDWSQKSDDY  240
CSTYHTQLAP AEGYLGRPPV VRPGGIGLKD NLLFAALSSR AQGKDVGIPE CEGAATAKSP  300
WNAPELFDLI VLDGETIREW LFFDKPRRAF ESGSRKQRSL PDYNGRGWHE SRKQLVKEFN  360
GLKRSYYMDP QPMENFEWHL YEYEINEYDA CTLYRLELKR ADGKKSPKGK LGNDSVADLQ  420
KQMGRLTAEF PNEKQRSVKE RRKSKDET
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV53223.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086027.10.0transcription factor VOZ1-like isoform X1
RefseqXP_011086028.10.0transcription factor VOZ1-like isoform X1
RefseqXP_020551529.10.0transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2Z7D1I70.0A0A2Z7D1I7_9LAMI; Uncharacterized protein
STRINGMigut.M01093.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]