PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV52692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family G2-like
Protein Properties Length: 420aa    MW: 45873.9 Da    PI: 6.5089
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV52692.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.91.9e-27152206156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k +++WtpeLH+rFv+ave+L G +kA+P++ilelm++++Lt+++++SHLQkYR++
  KZV52692.1 152 KVKVDWTPELHRRFVQAVEKL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 206
                 5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.498149208IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-26150209IPR009057Homeodomain-like
SuperFamilySSF466894.48E-18150209IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26152206IPR006447Myb domain, plants
PfamPF002492.8E-8155204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MLAVSPLRSA KNDRESEMEG FTVEENGFLD FSGGNLLDSI DFDDLFMGIN DGDLEMDSEI  60
LAEFSVSGGE ESERNCTSAV STDDSGKDDK VSVSVSASDL GSRSSSLINQ GEEIVSKRDM  120
GHATVNPSPE ETHDSKGRKS SAQSKNPLGK RKVKVDWTPE LHRRFVQAVE KLGVDKAVPS  180
RILELMGIDC LTRHNIASHL QKYRSHRKHL LAREAEAANW SQRRQIYGAG SGTGKRDITP  240
WIAPTMGFPP PAPMPHFRPL HVWGHPSVDQ SFMHTWPKHL TPSPPPPQPP HAWPPPLHPL  300
LPPPSADPSF WHSHHHVPTP GTPCFPPHMP PTTFPSPTVQ GIAPTGMYRV DPVVGVPTMP  360
PGQTLPEPPV DFHPNVDSII GDVLSKPWLP LPLGLKPPSI DGVLVELQRQ GISKIPPSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-16149204257ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that functions with GLK2 to promote chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. Acts in a cell-autonomous manner to coordinate and maintain the photosynthetic apparatus within individual cells. May function in photosynthetic capacity optimization by integrating responses to variable environmental and endogenous cues (PubMed:11828027, PubMed:12220263, PubMed:17533111, PubMed:18643989, PubMed:19376934, PubMed:19383092, PubMed:19726569). Prevents premature senescence (PubMed:23459204). {ECO:0000269|PubMed:11828027, ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:17533111, ECO:0000269|PubMed:18643989, ECO:0000269|PubMed:19376934, ECO:0000269|PubMed:19383092, ECO:0000269|PubMed:19726569, ECO:0000269|PubMed:23459204}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV52692.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. Repressed by BZR2. {ECO:0000269|PubMed:12220263, ECO:0000269|PubMed:21214652}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022877229.11e-175probable transcription factor GLK1 isoform X2
SwissprotQ9SIV31e-84GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A2Z7CZQ30.0A0A2Z7CZQ3_9LAMI; Uncharacterized protein
STRINGGLYMA13G37010.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25322356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-66GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Leister D,Kleine T
    Definition of a core module for the nuclear retrograde response to altered organellar gene expression identifies GLK overexpressors as gun mutants.
    Physiol Plant, 2016. 157(3): p. 297-309
    [PMID:26876646]
  2. Nagatoshi Y, et al.
    GOLDEN 2-LIKE transcription factors for chloroplast development affect ozone tolerance through the regulation of stomatal movement.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(15): p. 4218-23
    [PMID:27035938]
  3. Tokumaru M, et al.
    Ubiquitin-Proteasome Dependent Regulation of the GOLDEN2-LIKE 1 Transcription Factor in Response to Plastid Signals.
    Plant Physiol., 2017. 173(1): p. 524-535
    [PMID:27821720]
  4. Ni F, et al.
    Turnip Yellow Mosaic Virus P69 Interacts with and Suppresses GLK Transcription Factors to Cause Pale-Green Symptoms in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 764-766
    [PMID:27964999]
  5. Wang H,Seo JK,Gao S,Cui X,Jin H
    Silencing of AtRAP, a target gene of a bacteria-induced small RNA, triggers antibacterial defense responses through activation of LSU2 and down-regulation of GLK1.
    New Phytol., 2017. 215(3): p. 1144-1155
    [PMID:28656601]