PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV51974.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Dof
Protein Properties Length: 262aa    MW: 28978.9 Da    PI: 8.7296
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV51974.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof106.61.3e-333489459
      zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                + lkcprC stntkfCy+nny+ sqPr+fCk+C+r+WtkGG+lrnvP Ggg ++++
  KZV51974.1 34 HPLKCPRCGSTNTKFCYFNNYNKSQPRHFCKSCKRHWTKGGTLRNVPAGGGHKNKR 89
                6799***********************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-202989IPR003851Zinc finger, Dof-type
PfamPF027015.9E-303589IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.8973690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGLSTKQVYD DDHGRGMDQT LVQEGSPELS KSAHPLKCPR CGSTNTKFCY FNNYNKSQPR  60
HFCKSCKRHW TKGGTLRNVP AGGGHKNKRP KITNSATAAS TLGPKNRRNL PSSNNNDHQK  120
TVSHIIYHPI KGSPPSSLSH CTHTTNGIHP TGLNHNVSVP SCTNPNIEFG IKITSLDTYP  180
TTYQSLKEYD HCPSNPESTI TKENTSSSRR SIPWPNSGNG SSSDLPSNWD WNDINHVLTS  240
SDHLNVAWDD IDDLEIKAYT QA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.19e-62PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A022QJ287e-54A0A022QJ28_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-28DOF zinc finger protein 1